DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and pla2g3

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001032489.1 Gene:pla2g3 / 641423 ZFINID:ZDB-GENE-051113-96 Length:528 Species:Danio rerio


Alignment Length:151 Identity:60/151 - (39%)
Similarity:81/151 - (53%) Gaps:10/151 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 ESGVRGAAAVHRRERRQLSDWLIAPNTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWIDG 127
            :|.|.....:.|.:|.    |:| |.|.|||.||.|.| :.|||...:.|||||:|||||..|..
Zfish   142 DSDVSSIKTLQRSKRA----WMI-PGTLWCGSGNKATG-WTDLGVFEETDKCCREHDHCKHTIPS 200

  Fly   128 MSNRYDLFNYRPYTLSHCSCDLRFRTCLKMAGDEDANAIGKLFFNVVQTQCFGLKAETVCVQRGG 192
            .|..:.:||...:|||||.||.|||.||....:..:|.:|..||||::..||.....|.|.:|..
Zfish   201 FSYDHGVFNTNLFTLSHCDCDNRFRRCLLGVNNSMSNLVGYGFFNVLKMSCFKFSQRTQCAKRTW 265

  Fly   193 SGKETDPCLKEEVRHKAFLRD 213
            .|:    |:..|:...|.::|
Zfish   266 WGR----CVMSELAQYAVVKD 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 47/96 (49%)
pla2g3NP_001032489.1 PLA2_bee_venom_like 158..254 CDD:153093 48/97 (49%)
PLA2_like <374..450 CDD:297013
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579353
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MF1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 1 1.000 - - otm25517
orthoMCL 1 0.900 - - OOG6_116629
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5827
SonicParanoid 1 1.000 - - X3866
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1110.730

Return to query results.
Submit another query.