powered by:
Protein Alignment GIIIspla2 and PLA2G2A
DIOPT Version :9
Sequence 1: | NP_001285008.1 |
Gene: | GIIIspla2 / 31747 |
FlyBaseID: | FBgn0030013 |
Length: | 217 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_000291.1 |
Gene: | PLA2G2A / 5320 |
HGNCID: | 9031 |
Length: | 144 |
Species: | Homo sapiens |
Alignment Length: | 103 |
Identity: | 21/103 - (20%) |
Similarity: | 29/103 - (28%) |
Gaps: | 48/103 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 95 GNLAN--------------------GTYNDLGGASK----ADKCCRKHDHCKMWID--GMSNRYD 133
|||.| |.:..:||... .|:||..||.|...:: |...:
Human 20 GNLVNFHRMIKLTTGKEAALSYGFYGCHCGVGGRGSPKDATDRCCVTHDCCYKRLEKRGCGTK-- 82
Fly 134 LFNYRPYTLSH-----------------CSCDLRFRTC 154
:..|..|: |.||....||
Human 83 ---FLSYKFSNSGSRITCAKQDSCRSQLCECDKAAATC 117
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1422829at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.