DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and PLA2G3

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_056530.2 Gene:PLA2G3 / 50487 HGNCID:17934 Length:509 Species:Homo sapiens


Alignment Length:166 Identity:61/166 - (36%)
Similarity:86/166 - (51%) Gaps:15/166 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PGTDAKHLAIRLRDPQSEIES----ETVPLAHVHSHSHTDESGVRGAAAVHRRERRQLSDWLIAP 87
            ||.:.:.....|   ||:.|:    |..| |.........:|||.|..  |:||:|   .|.: |
Human   100 PGPELQRALATL---QSQWEACRALEESP-AGARKKRAAGQSGVPGGG--HQREKR---GWTM-P 154

  Fly    88 NTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWIDGMSNRYDLFNYRPYTLSHCSCDLRFR 152
            .|.|||.|:.| |..::||.....|.|||:||.|...|..:...|.:.|||.:|:|||.||.||:
Human   155 GTLWCGVGDSA-GNSSELGVFQGPDLCCREHDRCPQNISPLQYNYGIRNYRFHTISHCDCDTRFQ 218

  Fly   153 TCLKMAGDEDANAIGKLFFNVVQTQCFGLKAETVCV 188
            .||:...|..::.:|..||||::..||.|:.:..||
Human   219 QCLQNQHDSISDIVGVAFFNVLEIPCFVLEEQEACV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 40/96 (42%)
PLA2G3NP_056530.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 123..149 9/28 (32%)
Phospholipase A2-like. /evidence=ECO:0000269|PubMed:12522102, ECO:0000269|PubMed:15863501, ECO:0000269|PubMed:17868035 150..291 44/107 (41%)
PLA2_bee_venom_like 151..247 CDD:153093 41/97 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 283..354
PLA2_group_III_like 314..427 CDD:153094
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 458..482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145872
Domainoid 1 1.000 92 1.000 Domainoid score I7600
eggNOG 1 0.900 - - E1_28MF1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S8069
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 1 1.000 - - otm40907
orthoMCL 1 0.900 - - OOG6_116629
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5827
SonicParanoid 1 1.000 - - X3866
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1211.680

Return to query results.
Submit another query.