DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and pla2g10

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001002350.1 Gene:pla2g10 / 436622 ZFINID:ZDB-GENE-040718-41 Length:153 Species:Danio rerio


Alignment Length:94 Identity:28/94 - (29%)
Similarity:34/94 - (36%) Gaps:30/94 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 CGRGNLA-----NGTYNDLGG----ASKADKCCRKHDHCKMWIDG-------MSNRY-------- 132
            |..|..|     .|.|..|||    ..:||.||.|||.|  :.|.       .::||        
Zfish    39 CSTGRSALSYVMYGCYCGLGGQGWPRDRADWCCHKHDCC--YGDAEFAGCQTKTDRYHWTCDDEQ 101

  Fly   133 ---DLFNYRPYTLSHCSCDLRFRTCLKMA 158
               |..|.|...:. |.||.....||:.|
Zfish   102 ADCDSLNDRCAKIL-CRCDREAARCLRKA 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 28/94 (30%)
pla2g10NP_001002350.1 PLA2c 29..143 CDD:153091 28/94 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.