DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and Pla2g3

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001099485.1 Gene:Pla2g3 / 289733 RGDID:1305323 Length:506 Species:Rattus norvegicus


Alignment Length:193 Identity:73/193 - (37%)
Similarity:95/193 - (49%) Gaps:25/193 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IANERTICALMPL--VILATWQLCLLPGTDAKHLAIRLRDPQSEIE----SETVPLAHVHSHSHT 61
            ||..|.:||..||  ..:.|      ||.:.:.....|   ||:.|    ||..|.......   
  Rat    80 IAAFRALCAHEPLRHAFIHT------PGPELQRALATL---QSQWEACRRSEASPTGAREKR--- 132

  Fly    62 DESGVRGA-AAVHRRERRQLSDWLIAPNTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWI 125
             |:..||| |..|:|.||   .|.| |.|.|||.||.|... ::||.....|.|||:||.|...|
  Rat   133 -ETEHRGAPAGEHQRRRR---GWTI-PGTLWCGVGNSAENA-SELGMFHGPDFCCREHDQCPQTI 191

  Fly   126 DGMSNRYDLFNYRPYTLSHCSCDLRFRTCLKMAGDEDANAIGKLFFNVVQTQCFGLKAETVCV 188
            ..:...|.:.|:|.:|:|||.||.||:.||:..||..|:.:|..||||::..||.||.:..||
  Rat   192 SPLQYNYGIRNFRFHTISHCDCDARFQQCLRSQGDSIADIMGVAFFNVLEIPCFVLKEQETCV 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 42/96 (44%)
Pla2g3NP_001099485.1 PLA2_bee_venom_like 151..247 CDD:153093 43/97 (44%)
PLA2_group_III_like 299..424 CDD:153094
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MF1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 1 1.000 - - oto96448
orthoMCL 1 0.900 - - OOG6_116629
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3866
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.700

Return to query results.
Submit another query.