| Sequence 1: | NP_001285008.1 | Gene: | GIIIspla2 / 31747 | FlyBaseID: | FBgn0030013 | Length: | 217 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_766379.2 | Gene: | Pla2g3 / 237625 | MGIID: | 2444945 | Length: | 504 | Species: | Mus musculus |
| Alignment Length: | 211 | Identity: | 68/211 - (32%) |
|---|---|---|---|
| Similarity: | 91/211 - (43%) | Gaps: | 55/211 - (26%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 28 GTDAKHLAI---------RLRDPQSEIESETV----------PLAH------------------- 54
Fly 55 ---VHSHSHTDESGVRGAAAV---------HRRERRQLSDWLIAPNTRWCGRGNLANGTYNDLGG 107
Fly 108 ASKADKCCRKHDHCKMWIDGMSNRYDLFNYRPYTLSHCSCDLRFRTCLKMAGDEDANAIGKLFFN 172
Fly 173 VVQTQCFGLKAETVCV 188 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| GIIIspla2 | NP_001285008.1 | PLA2_bee_venom_like | 84..181 | CDD:153093 | 41/96 (43%) |
| Pla2g3 | NP_766379.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 115..143 | 6/27 (22%) | |
| Phospholipase A2-like. /evidence=ECO:0000250|UniProtKB:Q9NZ20 | 146..287 | 46/107 (43%) | |||
| PLA2_bee_venom_like | 147..243 | CDD:153093 | 42/97 (43%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 285..350 | ||||
| PLA2_group_III_like | 295..422 | CDD:153094 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C167835950 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_28MF1 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S8069 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0003412 | |
| OrthoInspector | 1 | 1.000 | - | - | otm42980 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_116629 | |
| Panther | 1 | 1.100 | - | - | O | PTHR12253 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R5827 |
| SonicParanoid | 1 | 1.000 | - | - | X3866 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 1 | 0.960 | - | - | ||
| 11 | 10.680 | |||||