DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and Oc90

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_011243790.1 Gene:Oc90 / 18256 MGIID:1313269 Length:486 Species:Mus musculus


Alignment Length:138 Identity:30/138 - (21%)
Similarity:46/138 - (33%) Gaps:29/138 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 NTRWCGRGNLANGTYNDLGGA----------SKADKCCRKHDHC----------------KMWID 126
            |:..|..| |....:.|.|.|          .::|.||.:|..|                ...:|
Mouse    80 NSMRCVTG-LCPRDFEDYGCACRFEMEGMPVDESDICCFQHRRCYEEAVEMDCLQDPAKLSADVD 143

  Fly   127 GMSNRYDLFNYRPYTLSHCSCDLRFRTCLKMAG-DEDANAIGKLFFNVVQTQCFGLKAETVCVQR 190
            ..:.:....:..|.....|:||.....||..:| :...|.:...|......:....||.|: :.|
Mouse   144 CTNKQITCESEDPCERLLCTCDKAAVECLAQSGINSSLNFLDASFCLPQTPETTSGKAATL-LPR 207

  Fly   191 GGSGKETD 198
            |...|.||
Mouse   208 GIPEKPTD 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 22/119 (18%)
Oc90XP_011243790.1 otoconin_90 77..194 CDD:153096 22/114 (19%)
otoconin_90 318..433 CDD:153096
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1422829at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.