DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and PROCA1

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001353230.1 Gene:PROCA1 / 147011 HGNCID:28600 Length:364 Species:Homo sapiens


Alignment Length:154 Identity:36/154 - (23%)
Similarity:65/154 - (42%) Gaps:37/154 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 RERRQLSDWLIAPNTRWCGRGNLANG--------TYNDLGGASKADKCCRKHDHCKMWI------ 125
            |:..:|..|         .||:|..|        |::: |...:.||||.:|..|...|      
Human    30 RDVNRLPSW---------ERGHLLAGVASSTDVSTFSE-GDCKEPDKCCWRHKQCTGHIIYPFAS 84

  Fly   126 DGMSNRYDLFNYRPYTLSHCSCDLRFRTCLKMAGDEDANA--IGKLFFNVVQTQCFGLKAETVCV 188
            |.:.:...|     ::::||:|:.|    ||.:.::.:::  .|....:|:::.||.|..|...|
Human    85 DCVRHSLHL-----HSVNHCNCNSR----LKDSSEDSSSSRGAGPTCSHVIESPCFELTPEEEHV 140

  Fly   189 QRGGSG--KETDPCLKEEVRHKAF 210
            :|...|  |...|.....:.|..:
Human   141 ERFRYGWCKSYRPVSVAVIHHPLY 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 25/112 (22%)
PROCA1NP_001353230.1 PLA2_group_III_like 33..132 CDD:153094 26/117 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 172..364
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145869
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28MF1
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.