DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and pla2g3

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_031747444.1 Gene:pla2g3 / 105946306 XenbaseID:XB-GENE-6086963 Length:370 Species:Xenopus tropicalis


Alignment Length:152 Identity:59/152 - (38%)
Similarity:84/152 - (55%) Gaps:8/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SGVRGAAAVHRRERRQLSDWLIAPNTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWIDGM 128
            :.|.||....|.:|     .|..|.|.|||.|:.|: .:.:||..:.||.|||:||||...|:..
 Frog    21 NSVSGAKTGDRYKR-----GLTMPGTLWCGAGSSAD-NFTNLGIFNGADLCCREHDHCSHQIEAF 79

  Fly   129 SNRYDLFNYRPYTLSHCSCDLRFRTCLKMAGDEDANAIGKLFFNVVQTQCFGLKAETVCVQ--RG 191
            ..:|.:.|||.:|:|||.||.|||.||....|..:..:|.:|||:::..||.||.|..||:  ..
 Frog    80 QFQYGMRNYRLHTVSHCDCDQRFRLCLNAFNDTISTLVGIMFFNILEMPCFSLKEEEQCVEWFWW 144

  Fly   192 GSGKETDPCLKEEVRHKAFLRD 213
            |..|:.|...|.|::.:||..:
 Frog   145 GGCKKFDLVPKAELQKQAFFNN 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 42/96 (44%)
pla2g3XP_031747444.1 Phospholip_A2_2 38..132 CDD:399082 41/94 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 1 1.000 - - otm48104
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5827
SonicParanoid 1 1.000 - - X3866
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.