DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GIIIspla2 and LOC101885160

DIOPT Version :9

Sequence 1:NP_001285008.1 Gene:GIIIspla2 / 31747 FlyBaseID:FBgn0030013 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_005169114.1 Gene:LOC101885160 / 101885160 -ID:- Length:463 Species:Danio rerio


Alignment Length:132 Identity:51/132 - (38%)
Similarity:71/132 - (53%) Gaps:6/132 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 WLIAPNTRWCGRGNLANGTYNDLGGASKADKCCRKHDHCKMWIDGMSNRYDLFNYRPYTLSHCSC 147
            |:: |.|.|||||..|| .|..||....||:|||:||||:..|...|..:.:||...:|:|||.|
Zfish   153 WVL-PGTLWCGRGTNAN-DYEQLGMFEHADRCCREHDHCEHIIRSFSVNFGVFNPTFFTVSHCDC 215

  Fly   148 DLRFRTCLKMAGDEDANAIGKLFFNVVQTQCFGLKAETVCVQRGGSGKETDPCLKEEVRHKAFLR 212
            |.||:.||....|..:|.:|..||||::.:||.......|.|....|.    |...::...|.::
Zfish   216 DHRFKQCLLGGNDTISNMVGYSFFNVLKIRCFEFIQRRQCTQYNWLGL----CTMVKLAPVAIMK 276

  Fly   213 DN 214
            |:
Zfish   277 DS 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GIIIspla2NP_001285008.1 PLA2_bee_venom_like 84..181 CDD:153093 44/96 (46%)
LOC101885160XP_005169114.1 Phospholip_A2_2 155..249 CDD:283483 44/95 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170579354
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003412
OrthoInspector 1 1.000 - - otm25517
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.