DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and TRAF1

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001177874.1 Gene:TRAF1 / 7185 HGNCID:12031 Length:416 Species:Homo sapiens


Alignment Length:460 Identity:87/460 - (18%)
Similarity:157/460 - (34%) Gaps:169/460 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 AAGGGASGAPTPPKSLALNQNHHYAPGSDTSGEQEEELLDSRYECAICIDWLNEPVLTSCGHRFC 124
            |:..|:|..|.|.:    |:.....|.:.....:|..        |:|                |
Human     2 ASSSGSSPRPAPDE----NEFPFGCPPTVCQDPKEPR--------ALC----------------C 38

  Fly   125 RSCLTAWMQKNNQCCPMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHL 189
            ..||:            :|.| :.|..|.|    :...|.|:...|.|.|               
Human    39 AGCLS------------ENPR-NGEDQICP----KCRGEDLQSISPGSRL--------------- 71

  Fly   190 PSCPYRRQQEPQEE------KCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIA 248
                 |.|::...|      .||||.:.|.|.|.|::  ::||.......|:.|:|...:|    
Human    72 -----RTQEKAHPEVAEAGIGCPFAGVGCSFKGSPQS--VQEHEVTSQTSHLNLLLGFMKQ---- 125

  Fly   249 TWQPHKPSTSGAAVENG---------------------------------HGQQQLP-------- 272
             |:    :..|..:|:|                                 ..|::|.        
Human   126 -WK----ARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEK 185

  Fly   273 ------------------------------PPPQYANGVDEQIVQTMYQRIVVLEQRTREQETRL 307
                                          ....:.:.:|.:.:.::.||:|.|:|...:::..|
Human   186 LLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVVELQQTLAQKDQAL 250

  Fly   308 ENMQKQLRLARQQAPVDPRYSNGTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARL 372
            ..:::.||| .::|..|     ||.:|:|..:..............::|...||:.:|||.|.||
Human   251 GKLEQSLRL-MEEASFD-----GTFLWKITNVTRRCHESACGRTVSLFSPAFYTAKYGYKLCLRL 309

  Fly   373 NIQ----PRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDTIMTKPEI--LA 431
            .:.    .::.| |||.:.:|:.|.|..|.|||:.::...::   |....:|.....:|::  .:
Human   310 YLNGDGTGKRTH-LSLFIVIMRGEYDALLPWPFRNKVTFMLL---DQNNREHAIDAFRPDLSSAS 370

  Fly   432 FHKPR 436
            |.:|:
Human   371 FQRPQ 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 5/37 (14%)
Sina 163..>230 CDD:302762 18/72 (25%)
MATH_TRAF6 330..473 CDD:239745 29/113 (26%)
TRAF1NP_001177874.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24 6/25 (24%)
SMC_N <140..>263 CDD:330553 12/123 (10%)
TRAF_BIRC3_bd 184..244 CDD:318808 6/59 (10%)
MATH_TRAF1 267..413 CDD:239748 29/113 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.