DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and Rnf41

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001157709.1 Gene:Rnf41 / 67588 MGIID:1914838 Length:317 Species:Mus musculus


Alignment Length:244 Identity:57/244 - (23%)
Similarity:86/244 - (35%) Gaps:69/244 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GEQEEELLDSRYECAICIDWLNEPV-LTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFP 154
            |:.:|:|:     |.||...|.||| ...|.|.||.:|:|.|..: .|.||:|...::..|....
Mouse    10 GDVDEDLI-----CPICSGVLEEPVQAPHCEHAFCNACITQWFSQ-QQTCPVDRSVVTVAHLRPV 68

  Fly   155 DNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPE 219
            ....|..:.:|:..|.|:..|||.|.....|..||..|          |..|...:.|      |
Mouse    69 PRIMRNMLSKLQIACDNAVFGCSAVVRLDNLMSHLSDC----------EHNPKRPVTC------E 117

  Fly   220 TNQLEEHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQ 284
            .....|..|.::|:|..:              .|..|                            
Mouse   118 QGCGLEMPKDELPNHNCI--------------KHLRS---------------------------- 140

  Fly   285 IVQTMYQRIVVLEQRTREQETRLENMQKQLRL----ARQQAPVDPRYSN 329
            :||....||..||:.:.|.:.:|...::.::|    .|....|:|...|
Mouse   141 VVQQQQSRIAELEKTSAEHKHQLAEQKRDIQLLKAYMRAIRSVNPNLQN 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 16/38 (42%)
Sina 163..>230 CDD:302762 17/66 (26%)
MATH_TRAF6 330..473 CDD:239745 57/244 (23%)
Rnf41NP_001157709.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:319548 18/47 (38%)
modified RING-HC finger (C3HC3D-type) 18..56 CDD:319548 17/38 (45%)
USP8_interact 137..315 CDD:370198 15/81 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.