DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and lnx2b

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_998105.2 Gene:lnx2b / 564464 ZFINID:ZDB-GENE-040426-2500 Length:678 Species:Danio rerio


Alignment Length:315 Identity:73/315 - (23%)
Similarity:122/315 - (38%) Gaps:59/315 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GSDTSGEQEEELLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEH 150
            |.|:...:.::.:|....|.||:..|.:|:.|.|||.:|..||:.::. :...||:|.:|:..:.
Zfish    28 GQDSHLFEYQDEVDDELVCHICLQPLLQPMDTPCGHTYCFQCLSNFLH-DQDFCPVDRQRIQLQQ 91

  Fly   151 DIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPS-CP-YRRQQEPQEEKCPFAKIKCD 213
            ........|..:::|...||..| .|.:.....||..||.: || ::|.:|..|.|         
Zfish    92 CRASSLLVRNLLDKLAVLCPFRS-ECELSMQRCELQPHLHNRCPAFKRLREEAERK--------- 146

  Fly   214 FVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYA 278
              .||..|:|:.. |:|.........|...:||..: .|.:|.....|.|.|...     .|...
Zfish   147 --KRPSWNELKGS-KSDGDLADAKSAQTIGRTAQLS-APSEPGLVNPAFEEGEDD-----TPLRC 202

  Fly   279 NGVDEQIVQTMYQ---------RIVVLEQRTREQETRLENMQKQLRLARQQAPVDPRYSNGTIVW 334
            :.|.|..|..:::         |||      ..::|.|.|:..|..:.......|.:.:.|..:.
Zfish   203 SLVAEATVVELFREDPGEDLGLRIV------GGKDTPLGNIVIQEIVRDSLVARDGKLAPGDHIL 261

  Fly   335 RIEQLG-ALVARLRANANNQVYSHECYTSPHGYKFCARLNI--------QPRKPH 380
            .:..:. |.::..||.|        ....|     |:||.:        :||..|
Zfish   262 EVNDVSLASISHSRAIA--------VIRQP-----CSRLRLTVMQEKGFKPRPEH 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 13/37 (35%)
Sina 163..>230 CDD:302762 20/68 (29%)
MATH_TRAF6 330..473 CDD:239745 12/60 (20%)
lnx2bNP_998105.2 RING 46..82 CDD:214546 13/36 (36%)
PDZ_signaling 210..291 CDD:238492 18/99 (18%)
PDZ_signaling 325..406 CDD:238492
PDZ_signaling 451..537 CDD:238492
PDZ_signaling 587..671 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.