DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and traf2b

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_005165556.1 Gene:traf2b / 557526 ZFINID:ZDB-GENE-030131-5345 Length:532 Species:Danio rerio


Alignment Length:564 Identity:116/564 - (20%)
Similarity:189/564 - (33%) Gaps:209/564 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PTPPKSLALNQNHHYAPGSDTSGEQEEEL---LDSRYECAICIDWLNEPVLTSCGHRFCRSCLTA 130
            |:.|.||          .|...|...|.|   ::.:|:|..|.|.|.:|....||||||..|.  
Zfish    17 PSLPSSL----------DSTLPGISREVLSVSMEPKYQCQQCKDILRKPFQAQCGHRFCVFCF-- 69

  Fly   131 WMQKNNQCCPMDNKRLSAEHDI-----------------------FPDNYTRREIEQLKRDCPNS 172
                         |:|::...|                       ||||..||||:.|...|||.
Zfish    70 -------------KQLTSSGPIPCEACRAEGIFEEETSVLNIAVAFPDNAARREIDSLPAKCPNE 121

  Fly   173 SL-------------------------GCSVVASPIELHRH--------LPSCPY---------- 194
            ..                         .|.|:....|..||        ..:|.|          
Zfish   122 GCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEI 186

  Fly   195 -----------------RRQQEPQEE-------------KCPFAKIKCDFVGRPETNQLEEHLKA 229
                             .:::.|:|:             .|.|.:|.|..|  .:..:.:||.:.
Zfish   187 KAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKSACQFREIGCRAV--VDNCKQQEHEQT 249

  Fly   230 DMPHHMQLMLQAFQQTAI-----ATWQPHKPSTSGAAVENGHGQQQLP--PPPQYANGVD----- 282
            .:..|::|||.......:     ..||.          :.|.|..:.|  .||..|:.|.     
Zfish   250 SIMEHLRLMLALLSSMRLRAEGAGEWQE----------DVGLGLYRGPEDAPPAGAHNVGRGGGP 304

  Fly   283 --EQIVQTMYQRIVVLEQRT--------------REQETRLENMQKQLR-LARQQAPVDPRYS-- 328
              ::.|.|:...:.||.:..              |..:.::||:..::| |.|.....|.:.:  
Zfish   305 GVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAES 369

  Fly   329 ------------NGTIVWRIEQLG-----ALVARLRANANNQVYSHECYTSPHGYKFCARLNIQ- 375
                        :|..:|:|.:..     |:..|..|     ::|...|:|.:|||.|.||.:. 
Zfish   370 EQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPA-----MFSPAFYSSKYGYKMCLRLYLNG 429

  Fly   376 ---PRKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDTIMTKPEI--LAFHKP 435
               .|..| |||...:|:.:.|..|.|||..::.|.::   |....:|.....:|::  .:|.:|
Zfish   430 DGTGRGSH-LSLFFVVMKGKYDALLKWPFSQKVTLMLL---DQNNREHIIDAFRPDVSSTSFQRP 490

  Fly   436 REAISTRGFG-----FLEYANISNIIQLGFCADDRLLIKIEINI 474
               ||.....     |...|.::.  :..:..||.:.||..:::
Zfish   491 ---ISEMNIASGCPLFCPLAKLAG--KSSYLRDDTIFIKAIVDL 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 12/37 (32%)
Sina 163..>230 CDD:302762 20/139 (14%)
MATH_TRAF6 330..473 CDD:239745 40/158 (25%)
traf2bXP_005165556.1 RING 44..86 CDD:238093 15/56 (27%)
zf-TRAF 189..246 CDD:280357 7/58 (12%)
TRAF_BIRC3_bd 307..359 CDD:293278 10/51 (20%)
MATH_TRAF2 365..528 CDD:239747 40/176 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.