DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and rnf41

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_998681.1 Gene:rnf41 / 406837 ZFINID:ZDB-GENE-040426-2920 Length:318 Species:Danio rerio


Alignment Length:328 Identity:75/328 - (22%)
Similarity:121/328 - (36%) Gaps:99/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GEQEEELLDSRYECAICIDWLNEPV-LTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFP 154
            ||.:|:||     |.||...|.||| ...|.|.||.:|:|.|..: .|.||:|...::..|....
Zfish    10 GEVDEDLL-----CPICSGVLEEPVRAPHCEHAFCNACITQWFAQ-QQICPVDRTVVTLAHLRPV 68

  Fly   155 DNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYR-RQQEPQEEKCPFAKIKCDFVGRP 218
            ....|..:.:|:..|.|:..||:......:|..||..|.:. ::....||.|..           
Zfish    69 PRIMRNMLSKLQISCDNAGFGCTATLRLDQLQSHLKDCEHNPKRPVTCEEGCGL----------- 122

  Fly   219 ETNQLEEHLKADMPH-----HMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYA 278
                  |..|.:||:     |::.::|. |||.||..:.       .|.|:.|   ||....:  
Zfish   123 ------EMPKDEMPNHNCIKHLRSVVQQ-QQTKIADLEK-------TAAEHKH---QLAEQKR-- 168

  Fly   279 NGVDEQIVQTMYQRIVVLEQRTREQETRLENMQKQLRLARQQAPVDPRYSNGTIVW-------RI 336
               |.|:::. |.|.:      |.....|:|:::.:..            |..:.|       |:
Zfish   169 ---DIQLLKA-YMRAI------RSANPNLQNLEESIEY------------NEILEWVNSLQPARV 211

  Fly   337 EQLGALV----ARLRANANNQVYSHECYTSPHGYKFCARLNIQPRKPHVLSLHVHLMQSENDYHL 397
            .:.|.::    |.|:|.....:....|                     .||:...|:  ||.:..
Zfish   212 TRWGGMISTPDAVLQAVIKRSLIDSGC---------------------PLSIVNDLI--ENAHER 253

  Fly   398 DWP 400
            :||
Zfish   254 NWP 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 16/38 (42%)
Sina 163..>230 CDD:302762 14/67 (21%)
MATH_TRAF6 330..473 CDD:239745 14/82 (17%)
rnf41NP_998681.1 RING 18..55 CDD:238093 16/37 (43%)
USP8_interact 137..315 CDD:286082 34/178 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.