DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and elgi

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001261904.1 Gene:elgi / 39735 FlyBaseID:FBgn0283649 Length:315 Species:Drosophila melanogaster


Alignment Length:138 Identity:38/138 - (27%)
Similarity:60/138 - (43%) Gaps:17/138 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GEQEEELLDSRYECAICIDWLNEPV-LTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFP 154
            ||.:|||     .|.||...|.:|: ...|.|.|||.|:..|:.: ...||:|...|:..:....
  Fly    10 GEVDEEL-----TCPICSGVLEDPLQAVMCEHAFCRGCINEWLTR-QPTCPVDRNSLTTANLRAV 68

  Fly   155 DNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYR-RQQEPQEEKCPFAKIKCDFVGRP 218
            ....|..:.:|...|.|:..||:.|......:.||..|.:. ::..|.|:.|.|...|       
  Fly    69 PRILRNLLSRLSITCDNAPYGCTAVLKLDAYNSHLDECIHNPKRPFPCEKGCGFDIPK------- 126

  Fly   219 ETNQLEEH 226
              ::|::|
  Fly   127 --DELKDH 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 13/38 (34%)
Sina 163..>230 CDD:302762 16/65 (25%)
MATH_TRAF6 330..473 CDD:239745
elgiNP_001261904.1 RING 17..55 CDD:238093 13/38 (34%)
Sina 83..>157 CDD:302762 15/59 (25%)
USP8_interact 137..315 CDD:286082
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.