DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and Rnf41

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_006240834.1 Gene:Rnf41 / 362814 RGDID:1309557 Length:317 Species:Rattus norvegicus


Alignment Length:294 Identity:68/294 - (23%)
Similarity:110/294 - (37%) Gaps:84/294 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GEQEEELLDSRYECAICIDWLNEPV-LTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEHDIFP 154
            |:.:|:|:     |.||...|.||| ...|.|.||.:|:|.|..: .|.||:|...::..|....
  Rat    10 GDVDEDLI-----CPICSGVLEEPVQAPHCEHAFCNACITQWFSQ-QQTCPVDRSVVTVAHLRPV 68

  Fly   155 DNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPE 219
            ....|..:.:|:..|.|:..|||.|.....|..||..|    :..|:               ||.
  Rat    69 PRIMRNMLSKLQIACDNAVFGCSAVVRLDSLMSHLSDC----EHNPK---------------RPV 114

  Fly   220 TNQLEEHLKADMP----------HHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPP 274
            |  .|:....:||          .|::.::|. |||.||..:.       .:.|:.|   ||...
  Rat   115 T--CEQGCGLEMPKDELPNHNCIKHLRSVVQQ-QQTRIAELEK-------TSAEHKH---QLAEQ 166

  Fly   275 PQYANGVDEQIVQTMYQRIVVLEQRTREQETRLENMQKQLRLARQQAPVDPRYSNGTIVW----- 334
            .:     |.|:::. |.|.:      |.....|:|:::.:..            |..:.|     
  Rat   167 KR-----DIQLLKA-YMRAI------RSVNPNLQNLEETIEY------------NEILEWVNSLQ 207

  Fly   335 --RIEQLGALV----ARLRANANNQVYSHECYTS 362
              |:.:.|.::    |.|:|.....:....|..|
  Rat   208 PARVTRWGGMISTPDAVLQAVIKRSLVESGCPAS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 16/38 (42%)
Sina 163..>230 CDD:302762 16/66 (24%)
MATH_TRAF6 330..473 CDD:239745 8/44 (18%)
Rnf41XP_006240834.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:319548 18/47 (38%)
USP8_interact 137..315 CDD:401040 27/140 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.