DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and Lnx1

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001101828.1 Gene:Lnx1 / 360926 RGDID:1308159 Length:728 Species:Rattus norvegicus


Alignment Length:155 Identity:42/155 - (27%)
Similarity:65/155 - (41%) Gaps:28/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 PTP-PKSLALNQNHHYAPGSDTSGEQEE-----ELLDSRYECAICIDWLNEPVLTSCGHRFCRSC 127
            |:| |..:...|||        |.|:..     |.:|....|.||:..|.:|:.|.|||.:|..|
  Rat    12 PSPEPLCVVCGQNH--------SPEENHFYTYTEDVDDDLVCHICLQALLDPLDTPCGHTYCTLC 68

  Fly   128 LTAWMQKNNQCCPMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHL-PS 191
            ||.::.:.: .||:|.|.:..:|....:....:.:.:|..:||.:. .||.|.....|..|. .|
  Rat    69 LTNFLVEKD-FCPVDRKPVVLQHCKKSNILVNKLLNKLLVNCPFTE-HCSEVLQRCNLQYHFQTS 131

  Fly   192 CP-----------YRRQQEPQEEKC 205
            |.           .||.|:...:.|
  Rat   132 CKGASHYGLTKDRKRRSQDGCPDGC 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 14/37 (38%)
Sina 163..>230 CDD:302762 14/55 (25%)
MATH_TRAF6 330..473 CDD:239745
Lnx1NP_001101828.1 RING 45..81 CDD:214546 14/36 (39%)
DegQ <260..364 CDD:223343
PDZ_signaling 276..360 CDD:238492
PDZ_signaling 384..464 CDD:238492
PDZ_signaling 506..589 CDD:238492
PDZ_signaling 637..721 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.