DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and CG9014

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001285905.1 Gene:CG9014 / 34777 FlyBaseID:FBgn0028847 Length:328 Species:Drosophila melanogaster


Alignment Length:154 Identity:47/154 - (30%)
Similarity:71/154 - (46%) Gaps:27/154 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 GEQEEELLDSRYECAICIDWLNEPVLTS-CGHRFCRSCLTAWM-QKNNQCCPMDNKRLSAEHDIF 153
            |..:|||:     |.||.|.|.|||.:| |.|.|||:|:..|| ||  |.||:|...|...|.:.
  Fly    10 GHVDEELI-----CPICTDVLEEPVQSSECEHAFCRACIDKWMIQK--QICPVDRSGLLTSHLVP 67

  Fly   154 PDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQ-----------QEPQEEKCPF 207
            .....|..:.:||..|..|..||:.:.:..|...|:.:|.:..:           :.|::|   .
  Fly    68 VSRLMRNMLSRLKIKCTFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDE---M 129

  Fly   208 AKIKCDFVGRPETNQLEEHLKADM 231
            ::..|.|    |..:|.|.|..::
  Fly   130 SRHNCVF----ELRELVEKLAKEV 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 21/39 (54%)
Sina 163..>230 CDD:302762 17/77 (22%)
MATH_TRAF6 330..473 CDD:239745
CG9014NP_001285905.1 zf-C3HC4 18..55 CDD:278524 21/38 (55%)
USP8_interact 137..319 CDD:286082 4/13 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.