DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Traf6 and rnf41l

DIOPT Version :9

Sequence 1:	NP_511080.2	Gene:	Traf6 / 31746	FlyBaseID:	FBgn0265464	Length:	475	Species:	Drosophila melanogaster
Sequence 2:	XP_002664951.1	Gene:	rnf41l / 337495	ZFINID:	ZDB-GENE-030131-9441	Length:	292	Species:	Danio rerio

Alignment Length:	142	Identity:	42/142 - (29%)
Similarity:	61/142 - (42%)	Gaps:	26/142 - (18%)

- Green bases have known domain annotations that are detailed below.

  Fly    91 GEQEEELLDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAEH--DIF 153
            |...|.||     |.:|.|.|.:|:...|.|.||.:|:..|:..:|. ||.|...|...|  .:|
Zfish    10 GYVNEGLL-----CCVCRDVLEDPLQAPCEHAFCSTCIHGWLIHHNS-CPEDRLPLDITHLRPLF 68

  Fly   154 PDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRP 218
              .|.|.::.:|:..|.....||.|:.:...:|||             |::|.:|.:.|...|.|
Zfish    69 --RYMRNDLARLQVRCVFRPQGCEVICALESIHRH-------------EQQCDYALLNCTNTGCP 118

  Fly   219 ---ETNQLEEHL 227
               ....||.||
Zfish   119 VQVSRRSLEAHL 130

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Traf6	NP_511080.2	RING	103..141	CDD:238093	13/37 (35%)
		Sina	163..>230	CDD:302762	18/68 (26%)
		MATH_TRAF6	330..473	CDD:239745
rnf41l	XP_002664951.1	zf-RING_2	18..53	CDD:290367	12/35 (34%)
		Sina	82..>130	CDD:302762	15/60 (25%)
		DUF1640	150..>234	CDD:285090
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG0297
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D918518at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	3	2.820