DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and Traf1

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001313530.1 Gene:Traf1 / 22029 MGIID:101836 Length:409 Species:Mus musculus


Alignment Length:430 Identity:88/430 - (20%)
Similarity:150/430 - (34%) Gaps:143/430 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 SDTSGEQEEELLDSRYEC--AICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAE 149
            :.:|...|.|.   ::.|  |.|.|.....||          |.||.:.:|          |..:
Mouse     2 ASSSAPDENEF---QFGCPPAPCQDPSEPRVL----------CCTACLSEN----------LRDD 43

  Fly   150 HDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQ-----EPQEEKCPFAK 209
            .|               |.||.....        .||...|..|..:::     ...|..||||.
Mouse    44 ED---------------RICPKCRAD--------NLHPVSPGSPLTQEKVHSDVAEAEIMCPFAG 85

  Fly   210 IKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGA---AVENGHGQQQL 271
            :.|.|.|.|::  ::||.......|:.|:|...::     |:....|..|:   |:|....:.||
Mouse    86 VGCSFKGSPQS--MQEHEATSQSSHLYLLLAVLKE-----WKSSPGSNLGSAPMALERNLSELQL 143

  Fly   272 PPPPQ-----------------------------------------YANGV-------------- 281
            ....:                                         :||.|              
Mouse   144 QAAVEATGDLEVDCYRAPCCESQEELALQHLVKEKLLAQLEEKLRVFANIVAVLNKEVEASHLAL 208

  Fly   282 ---------DEQIVQTMYQRIVVLEQRTREQETRLENMQKQLRLARQQAPVDPRYSNGTIVWRIE 337
                     |.:.:.::.||:|.|:|...:::..|..::..||| .::|..|     ||.:|:|.
Mouse   209 AASIHQSQLDREHILSLEQRVVELQQTLAQKDQVLGKLEHSLRL-MEEASFD-----GTFLWKIT 267

  Fly   338 QLGALVARLRANANNQVYSHECYTSPHGYKFCARLNI----QPRKPHVLSLHVHLMQSENDYHLD 398
            .:..............::|...||:.:|||.|.||.:    ..:|.| |||.:.:|:.|.|..|.
Mouse   268 NVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTH-LSLFIVIMRGEYDALLP 331

  Fly   399 WPFKGRIKLCMVHPADATLSQHDTIMTKPEI--LAFHKPR 436
            |||:.::...::   |....:|.....:|::  .:|.:|:
Mouse   332 WPFRNKVTFMLL---DQNNREHAIDAFRPDLSSASFQRPQ 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 10/39 (26%)
Sina 163..>230 CDD:302762 18/71 (25%)
MATH_TRAF6 330..473 CDD:239745 30/113 (27%)
Traf1NP_001313530.1 SMC_prok_B <126..257 CDD:274008 18/131 (14%)
TRAF_BIRC3_bd 180..237 CDD:374713 9/56 (16%)
MATH_TRAF1 260..406 CDD:239748 30/113 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.