DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and trf-2

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_491534.2 Gene:trf-2 / 172151 WormBaseID:WBGene00022454 Length:335 Species:Caenorhabditis elegans


Alignment Length:333 Identity:70/333 - (21%)
Similarity:116/333 - (34%) Gaps:111/333 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 PNSSLGCSVVASPIELHRHLPSCPYRRQQEPQE-EKCPFAKIKCDFVGRPETNQLEEHLKADMPH 233
            |.:|.....|:.||.:....|:.|  :...|.. ..|||.:..|...|  |.::::.|::.|...
 Worm    52 PRTSTRSVGVSIPIHVEGEEPTAP--KSIVPDNWIDCPFKEHGCHKKG--ENSEVKRHVRDDRNL 112

  Fly   234 HMQLMLQA---------FQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTM 289
            |:.|:.|:         .||:|.                                 ||:.:....
 Worm   113 HLVLLCQSLNPIRTKINIQQSAY---------------------------------VDKYVGMLQ 144

  Fly   290 YQRIVVLEQRTREQETRLENMQKQLRLARQQAPVDPRYSNGTIVWRIEQLGALVARLRAN-ANNQ 353
            |..|.         |:..|....|                  ..:||.::|..|.:...| ::..
 Worm   145 YMSIA---------ESAFEKYGSQ------------------HTFRIPKIGLTVVKATKNKSHRS 182

  Fly   354 VYSHECYTSPHGYKFCARLNIQPRKPH--------VLSLHVHLMQSENDYHLDWPFKGRIKLCMV 410
            :||...|:..:|||..|     ...|:        ..|:.|.||:.|.|..|:|||:        
 Worm   183 IYSQPFYSHGYGYKMMA-----VAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFR-------- 234

  Fly   411 HPADATLS----QHDTIMTK-------PEILAFHKPREAISTRGFGFLEYANISNIIQLGFCADD 464
              .|.|.|    ....::||       |||..|.:..|.:....|||..:..::.:.:  |.||.
 Worm   235 --CDVTFSILSDDKKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVTE--FAADG 295

  Fly   465 RLLIKIEI 472
            .:.|:|::
 Worm   296 DIFIQIKV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093
Sina 163..>230 CDD:302762 15/60 (25%)
MATH_TRAF6 330..473 CDD:239745 41/163 (25%)
trf-2NP_491534.2 MATH_TRAF_C 158..304 CDD:238168 42/181 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D391991at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.