DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and RNF151

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_005255186.1 Gene:RNF151 / 146310 HGNCID:23235 Length:254 Species:Homo sapiens


Alignment Length:257 Identity:65/257 - (25%)
Similarity:100/257 - (38%) Gaps:50/257 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 PGSDT----SGEQEEELL----DSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWM--QKNNQCC 139
            ||:||    .|..:..|.    ||.:.|::|...|..|....|.|.||:.|:..|:  ||...||
Human     2 PGADTWPLQGGGYDLNLFASPPDSNFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCPCC 66

  Fly   140 PMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEK 204
            ..:.||....|    .|..|:.|.:|:..|.|:..||.|            :||...::..| :.
Human    67 RKEVKRKKVVH----MNKLRKTIGRLEVKCKNADAGCIV------------TCPLAHRKGHQ-DS 114

  Fly   205 CPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAI----ATWQPHKPSTSGA--AVE 263
            |||....|...|.  |:|:.....|:...|.|   |..||...    ||..|.:.:....  .:.
Human   115 CPFELTACPNEGC--TSQVPRGTLAEHRQHCQ---QGSQQRCPLGCGATLDPAERARHNCYRELH 174

  Fly   264 NGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRT---REQETRLENMQKQLRLARQQAP 322
            |....:|....|         ::.::.:|:..|:|.|   |.:...|.|..::.....:.||
Human   175 NAWSVRQERRRP---------LLLSLLRRVRWLDQATSVVRRELAELSNFLEEDTALLEGAP 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 14/39 (36%)
Sina 163..>230 CDD:302762 16/66 (24%)
MATH_TRAF6 330..473 CDD:239745
RNF151XP_005255186.1 RING 29..70 CDD:238093 14/40 (35%)
Sina 92..>139 CDD:302762 16/61 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.