DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and rnf151

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_004918118.1 Gene:rnf151 / 101733072 XenbaseID:XB-GENE-6467161 Length:212 Species:Xenopus tropicalis


Alignment Length:217 Identity:49/217 - (22%)
Similarity:83/217 - (38%) Gaps:46/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 CAICIDWLNEPVLTSCGHRFCRSCLTAWM--QKNNQCCPMD--NKRLSAEHDIFPDNYTRREIEQ 164
            |:||...:..||:.||||.|||:|:..|:  |:...||..:  .|.....|.:      :|:|.:
 Frog    20 CSICHGVMRCPVMISCGHIFCRNCIMQWLKRQRTCPCCRTEVRGKLYVLMHKL------KRKINR 78

  Fly   165 LKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKA 229
            |...|||...||....:.:....|             .|.|.:..:.|...|.|     .|.|:.
 Frog    79 LDVKCPNEQNGCPAHFALVHSQEH-------------AEYCAYGAVPCSNEGCP-----AEVLRK 125

  Fly   230 DMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIV 294
            ||..|:.         ....|:.|.....|..         |.|..:..:...:::.:...:::.
 Frog   126 DMCDHIH---------NCRYWRQHCHMGCGTL---------LHPENRETHNCYQELKEDYAKQLY 172

  Fly   295 VLEQRTREQETRLENMQKQLRL 316
            .|:|:....||....:.:||::
 Frog   173 KLKQKANRMETICCQISRQLQM 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 17/38 (45%)
Sina 163..>230 CDD:302762 14/66 (21%)
MATH_TRAF6 330..473 CDD:239745
rnf151XP_004918118.1 RING 20..61 CDD:238093 17/40 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.