DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and rnf41

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_002934542.1 Gene:rnf41 / 100489964 XenbaseID:XB-GENE-943148 Length:317 Species:Xenopus tropicalis


Alignment Length:294 Identity:69/294 - (23%)
Similarity:111/294 - (37%) Gaps:71/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 GSDTS---GEQEEELLDSRYECAICIDWLNEPV-LTSCGHRFCRSCLTAWMQKNNQCCPMDNKRL 146
            |.|.|   |:.:|:|:     |.||...|.||| ...|.|.||.:|:|.|..: .|.||:|...:
 Frog     2 GYDVSRFQGDVDEDLI-----CPICSGVLEEPVQAPHCEHAFCNACITQWFSQ-QQTCPVDRSVV 60

  Fly   147 SAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIK 211
            :..|........|..:.:|:..|.|:..||:.:.....|..||..|          |..|...:.
 Frog    61 TVAHLRPVPRIMRNMLSKLQITCDNAVFGCTTIVRLDNLMSHLSDC----------EHNPKRPVT 115

  Fly   212 CDFVGRPETNQLEEHLKADMPHH--MQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPP 274
            |      |.....|..|.::|:|  ::.:....||..|...:..|     ||.|:.|   ||...
 Frog   116 C------EQGCGLEMPKDELPNHNCIKHLRSVVQQQQIRIGELEK-----AAAESKH---QLSEQ 166

  Fly   275 PQYANGVDEQIVQTMYQRIVVLEQRTREQETRLENMQKQLRLARQQAPVDPRYSNGTIVW----- 334
            .:     |.|:::. |.|.:      |.....|:|:::.:..            |..:.|     
 Frog   167 KR-----DIQLLKA-YMRAI------RSANPNLQNLEETIEY------------NEILEWVNSLQ 207

  Fly   335 --RIEQLGALV----ARLRANANNQVYSHECYTS 362
              |:.:.|.::    |.|:|.....:....|..|
 Frog   208 PARVTRWGGMISTPDAVLQAVIKRSLVESGCPAS 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 16/38 (42%)
Sina 163..>230 CDD:302762 15/66 (23%)
MATH_TRAF6 330..473 CDD:239745 8/44 (18%)
rnf41XP_002934542.1 mRING-HC-C3HC3D_Nrdp1 15..57 CDD:319548 18/47 (38%)
modified RING-HC finger (C3HC3D-type) 18..56 CDD:319548 17/38 (45%)
USP8_interact 137..315 CDD:370198 26/137 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.