DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and lnx1

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_017950997.2 Gene:lnx1 / 100487348 XenbaseID:XB-GENE-952178 Length:742 Species:Xenopus tropicalis


Alignment Length:348 Identity:71/348 - (20%)
Similarity:118/348 - (33%) Gaps:120/348 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 PKSLAL--------NQNHHYAPGSDTSGEQEEELLDSRYECAICIDWLNEPVLTSCGHRFCRSCL 128
            |:||..        .:||.|.    .:.|.:::||     |.||:..|.:|:.|.|||.:|..||
 Frog    15 PQSLCTVCGQLHSEEENHSYT----YTEEVDDDLL-----CNICLHALIQPLDTPCGHTYCTLCL 70

  Fly   129 TAWMQKNNQCCPMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLP-SC 192
            |::: .:...||:|.|.:                  |.:.|..|::   :|.:.::   .|| .|
 Frog    71 TSFL-VHEDFCPVDRKHI------------------LLQTCKKSTI---LVKNLLD---KLPVIC 110

  Fly   193 PYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLK-----------------------ADMPHH 234
            |::       |.|.....:||         ||||.:                       ||....
 Frog   111 PFK-------EHCTDIVQRCD---------LEEHFQNRCKGASHYGLTKERKRRSQDSSADCSSS 159

  Fly   235 MQLMLQAFQQTAIATWQPHKPSTSGAAV---ENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVL 296
            :.|        .:|...|...:::..|:   |.|.......|    |.|......:.        
 Frog   160 LDL--------TVAAVSPELSASAAIALATEETGQDNPAFSP----AKGESHTACEA-------- 204

  Fly   297 EQRTREQETRLENMQKQLRLARQQAPVDPRYSNGTIVWRIEQLGALVA----RLRANANN----- 352
            |:..|....|..|.::....:.....::..:|    |.|..:.|:.|.    |.|||..|     
 Frog   205 EENCRLNRNRNRNFERSTVRSLSFKKLNRAFS----VLRRTKSGSSVVHASDRERANLQNANIVE 265

  Fly   353 --QVYSHECYTSPHGYKFCARLN 373
              .....:.:..|.|...|.::|
 Frog   266 DPMGLPRQYHLIPDGEITCIKIN 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 14/37 (38%)
Sina 163..>230 CDD:302762 16/90 (18%)
MATH_TRAF6 330..473 CDD:239745 13/55 (24%)
lnx1XP_017950997.2 mRING-HC-C3HC3D_LNX1 43..84 CDD:319693 17/46 (37%)
PDZ_signaling 282..366 CDD:238492 2/7 (29%)
PDZ_signaling 390..470 CDD:238492
PDZ_signaling 516..>585 CDD:238492
PDZ_signaling 651..735 CDD:238492
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.