DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and pdzrn3b

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:NP_001243321.1 Gene:pdzrn3b / 100005518 ZFINID:ZDB-GENE-071022-4 Length:1053 Species:Danio rerio


Alignment Length:231 Identity:52/231 - (22%)
Similarity:94/231 - (40%) Gaps:46/231 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LDSRYECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDNKRLSAE--HDIFPDNYTRR 160
            :|..::|.:|...|.:|:.|.|||.||..|:..|:.:.:. ||:..:|:|.:  :.:.|   .:.
Zfish    12 VDPDFKCNLCNKVLEDPLTTPCGHVFCAGCVLPWVVQQSS-CPVKCQRISTKELNHVLP---LKN 72

  Fly   161 EIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEE 225
            .|.:|...|.|.:.||..:.....|..|             .|.|.::..||...|..|...|: 
Zfish    73 LILKLDIKCDNHARGCEKIVKLQHLAEH-------------AEMCDYSPAKCRNKGCSEVLNLK- 123

  Fly   226 HLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLP-----PPPQYANGVDEQI 285
                ||..||:   ::....|:...:      ||..:...|.:.:|.     ...:..||     
Zfish   124 ----DMDAHMR---ESCDYRAVGICE------SGCGLMLTHKEHKLDNHCCLKALKAHNG----- 170

  Fly   286 VQTMYQRIVVLEQRTREQETRLENMQKQLRLARQQA 321
              .:..::|.|::..::|..:....:|.| ||:..|
Zfish   171 --ALQGKVVTLDKELKKQALKSTKREKSL-LAQLSA 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 13/37 (35%)
Sina 163..>230 CDD:302762 14/66 (21%)
MATH_TRAF6 330..473 CDD:239745
pdzrn3bNP_001243321.1 RING 17..58 CDD:238093 14/41 (34%)
PDZ 245..337 CDD:214570
PDZ_signaling 421..489 CDD:238492
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 563..604
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 747..855
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.