DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Traf6 and rnf151

DIOPT Version :9

Sequence 1:NP_511080.2 Gene:Traf6 / 31746 FlyBaseID:FBgn0265464 Length:475 Species:Drosophila melanogaster
Sequence 2:XP_001343919.2 Gene:rnf151 / 100004674 ZFINID:ZDB-GENE-121214-234 Length:243 Species:Danio rerio


Alignment Length:259 Identity:53/259 - (20%)
Similarity:93/259 - (35%) Gaps:51/259 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 TSGEQEEELLDSRYE---CAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQ--CC--PMDNKRL 146
            |.|.:.::.:|...:   |.||...|..||...|.|.||:.|:..||::..:  ||  .:|..::
Zfish     2 TGGYEVDQFVDPPDDDLICVICRAVLRCPVRLKCNHVFCKECILQWMKRQVKCPCCRQSIDQNQM 66

  Fly   147 SAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIK 211
            .....:      .:.|.:|...|.|...||.........:.|:.:|||..|..|.|        .
Zfish    67 LVLFKL------SKSIGRLSVKCRNGQQGCRATFPLSNEYLHISTCPYEWQICPHE--------G 117

  Fly   212 CDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGA-AVENGHGQQQLPPPP 275
            |.          ::.|:.|:..|.|         :...|:...|...|. .|.....|...    
Zfish   118 CG----------QQVLRKDVQAHDQ---------SCTHWRQLCPMGCGTLLVRENQTQHNC---- 159

  Fly   276 QYANGVDEQIVQTMYQRIVV--LEQRTREQETRLENMQKQLRLARQQAPV---DPRYSNGTIVW 334
             |.......:.:...||.:.  |.::.:..::|:..:::|:.|..:...|   :.....||..|
Zfish   160 -YRELQQRYLAERRKQRAIAANLRRKMQRMQSRMAQIKRQINLMCESLEVGDLETEAGEGTSAW 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Traf6NP_511080.2 RING 103..141 CDD:238093 15/44 (34%)
Sina 163..>230 CDD:302762 14/66 (21%)
MATH_TRAF6 330..473 CDD:239745 3/5 (60%)
rnf151XP_001343919.2 RING_Ubox 20..58 CDD:327409 14/37 (38%)
zf-TRAF 102..157 CDD:280357 16/81 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0297
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D918518at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.