Sequence 1: | NP_572453.1 | Gene: | CG18262 / 31745 | FlyBaseID: | FBgn0030012 | Length: | 469 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_010235.1 | Gene: | STP4 / 851512 | SGDID: | S000002206 | Length: | 490 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 266 | Identity: | 52/266 - (19%) |
---|---|---|---|
Similarity: | 74/266 - (27%) | Gaps: | 127/266 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 186 SLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYK--CNEEACNQTFRTERDLRGHRWKHTG 248
Fly 249 IFCDICGKPFTQSGNMMRHRQRH----------------SG------------------------ 273
Fly 274 ---------------------IK-PHKCP------ECDATFYTQKELSSHSI------CHTGRMP 304
Fly 305 CICEVCGRPCR-------------DRGVLTAHMRRHTGERPAKCEVCGKAF-------------- 342
Fly 343 --YSFH 346 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG18262 | NP_572453.1 | C2H2 Zn finger | 224..246 | CDD:275368 | 6/21 (29%) |
C2H2 Zn finger | 251..271 | CDD:275368 | 6/19 (32%) | ||
COG5048 | <256..415 | CDD:227381 | 33/194 (17%) | ||
zf-H2C2_2 | 263..288 | CDD:290200 | 12/92 (13%) | ||
C2H2 Zn finger | 279..327 | CDD:275368 | 14/72 (19%) | ||
zf-H2C2_2 | 320..342 | CDD:290200 | 5/21 (24%) | ||
C2H2 Zn finger | 335..355 | CDD:275368 | 7/28 (25%) | ||
C2H2 Zn finger | 363..383 | CDD:275368 | |||
zf-C2H2 | 389..411 | CDD:278523 | |||
C2H2 Zn finger | 391..411 | CDD:275368 | |||
STP4 | NP_010235.1 | COG5048 | 14..442 | CDD:227381 | 39/205 (19%) |
C2H2 Zn finger | 279..296 | CDD:275368 | 2/16 (13%) | ||
C2H2 Zn finger | 306..326 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24390 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |