DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and STP4

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_010235.1 Gene:STP4 / 851512 SGDID:S000002206 Length:490 Species:Saccharomyces cerevisiae


Alignment Length:266 Identity:52/266 - (19%)
Similarity:74/266 - (27%) Gaps:127/266 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 SLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYK--CNEEACNQTFRTERDLRGHRWKHTG 248
            |:.|....:|:.....||..||.....:|:|..|..:.  .|......|..|..| |.|:     
Yeast   247 SIHSPLTNEHTSRYSSSLKDSAKITKQRKKKECPICHNFYANLSTHKSTHLTPED-RPHK----- 305

  Fly   249 IFCDICGKPFTQSGNMMRHRQRH----------------SG------------------------ 273
              |.||.:.|.::.:::||::||                ||                        
Yeast   306 --CPICQRGFARNNDLIRHKKRHWKDEFMQIYARESDNNSGADDQDDTARTSANNDSDDSNDKLA 368

  Fly   274 ---------------------IK-PHKCP------ECDATFYTQKELSSHSI------CHTGRMP 304
                                 || ..|||      ..|...|..|   |.|:      ||...:.
Yeast   369 ASSSSEETKLLKKNQLKSLYKIKGAFKCPYNSTLINLDMEVYPHK---SRSLYFEPINCHQTGVF 430

  Fly   305 CICEVCGRPCR-------------DRGVLTAHMRRHTGERPAKCEVCGKAF-------------- 342
            ..|:......:             ||||:           |.||:.||..|              
Yeast   431 SRCDTFKNHLKALHFEYPPKTKKEDRGVV-----------PGKCKHCGLQFPNVDVWLNKHVGKG 484

  Fly   343 --YSFH 346
              ||:|
Yeast   485 CGYSYH 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/21 (29%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
COG5048 <256..415 CDD:227381 33/194 (17%)
zf-H2C2_2 263..288 CDD:290200 12/92 (13%)
C2H2 Zn finger 279..327 CDD:275368 14/72 (19%)
zf-H2C2_2 320..342 CDD:290200 5/21 (24%)
C2H2 Zn finger 335..355 CDD:275368 7/28 (25%)
C2H2 Zn finger 363..383 CDD:275368
zf-C2H2 389..411 CDD:278523
C2H2 Zn finger 391..411 CDD:275368
STP4NP_010235.1 COG5048 14..442 CDD:227381 39/205 (19%)
C2H2 Zn finger 279..296 CDD:275368 2/16 (13%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.