DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and STP3

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_013479.3 Gene:STP3 / 851089 SGDID:S000004367 Length:343 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:43/167 - (25%)
Similarity:63/167 - (37%) Gaps:38/167 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 GVLTAHMRRHTGERPAK-CEVCGKAFYSFHDLNVHAVSHTNL--RPFVCDVCGSTFQRKKALRVH 379
            ||.|.|..:....|..| |.:| :.||:  :|..|..:|...  ||..|.:|...|.|...|..|
Yeast   126 GVSTPHSTKINKPRKKKQCPIC-RNFYA--NLTTHKATHLTPEDRPHKCPICHRGFARNNDLLRH 187

  Fly   380 KLLHSEQRKYACKLCGKTFAQSGGLNAHM------------RSHDPARVKGAVKPLPQSVTIEVI 432
            |..|.:.         :..:|||.|:.|.            .:|:......:|....|..::..|
Yeast   188 KKRHWKD---------EILSQSGVLSNHNDGKGGSVSPNDDDTHEKMTPMNSVTDYAQLKSLHQI 243

  Fly   433 EG--KSP-PTTTITMAID--------LNVEEQLVKQT 458
            :|  |.| .:|.|.:.:|        ||.|.....||
Yeast   244 KGTFKCPFNSTLIQLDMDMYPYKLKPLNFETSNCHQT 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368
C2H2 Zn finger 251..271 CDD:275368
COG5048 <256..415 CDD:227381 29/111 (26%)
zf-H2C2_2 263..288 CDD:290200
C2H2 Zn finger 279..327 CDD:275368 4/8 (50%)
zf-H2C2_2 320..342 CDD:290200 6/22 (27%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-C2H2 389..411 CDD:278523 5/33 (15%)
C2H2 Zn finger 391..411 CDD:275368 5/31 (16%)
STP3NP_013479.3 COG5048 <137..295 CDD:227381 39/156 (25%)
C2H2 Zn finger 144..161 CDD:275368 6/19 (32%)
C2H2 Zn finger 171..191 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.