DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and DAZ2

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_195254.1 Gene:DAZ2 / 829681 AraportID:AT4G35280 Length:284 Species:Arabidopsis thaliana


Alignment Length:313 Identity:65/313 - (20%)
Similarity:101/313 - (32%) Gaps:120/313 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 RRLKHSEANGGSLDKSASERNSKKRKGP--PKVYK-CNEEACNQTFRTERDLRGHRWKHTGIFCD 252
            :|.|...::..|..||||:....|:..|  ||:.: |.|  |.:.|          |....:|  
plant    43 KRTKTVASSSSSSPKSASKPKYTKKPDPNAPKITRPCTE--CGRKF----------WSWKALF-- 93

  Fly   253 ICGKPFTQSGNMMRHRQRH-SGIKP---HKCPECDATFYTQKELS-------------SHSICHT 300
                     |:|..|.:|. .||.|   ::.|    |..:.|:|:             .|.:.  
plant    94 ---------GHMRCHPERQWRGINPPPNYRVP----TAASSKQLNQILPNWVSFMSEEDHEVA-- 143

  Fly   301 GRMPCICEVC-GRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLR----- 359
               .|:..:. |.|.      ::.:.|.      :|..|.|.|.|...|..|..||.|::     
plant   144 ---SCLLMLSNGTPS------SSSIERF------ECGGCKKVFGSHQALGGHRASHKNVKGCFAI 193

  Fly   360 ------PFVCDVCGSTFQRKKALRVHKLLHSEQRK-------YACKLCGKTFAQSGGLNAHMRSH 411
                  |........              |..|.|       :.|.:|.:.|:....|..|||.|
plant   194 TNVTDDPMTVSTSSG--------------HDHQGKILTFSGHHKCNICFRVFSSGQALGGHMRCH 244

  Fly   412 DPARVKGAVKPLPQSVTIEVIEGKSPPTTTITMAIDLNVEEQLVKQTETAPTT 464
                                .|.:..|  .|:.|:|||| ...::...|:.|:
plant   245 --------------------WEKEEEP--MISGALDLNV-PPTIQDLSTSDTS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 3/19 (16%)
COG5048 <256..415 CDD:227381 38/194 (20%)
zf-H2C2_2 263..288 CDD:290200 8/28 (29%)
C2H2 Zn finger 279..327 CDD:275368 8/61 (13%)
zf-H2C2_2 320..342 CDD:290200 4/21 (19%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 0/19 (0%)
zf-C2H2 389..411 CDD:278523 7/21 (33%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
DAZ2NP_195254.1 zf-C2H2_6 79..102 CDD:404748 9/45 (20%)
zf-C2H2_6 161..185 CDD:404748 9/29 (31%)
zf-C2H2_6 221..247 CDD:404748 8/45 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.