DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and AT3G46070

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_190193.1 Gene:AT3G46070 / 823750 AraportID:AT3G46070 Length:170 Species:Arabidopsis thaliana


Alignment Length:136 Identity:35/136 - (25%)
Similarity:52/136 - (38%) Gaps:32/136 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 VLTAHMRRHTG--ERPAKCEVCGKAFYSFHDLNVHAVSHTNLR-------PFVCDVCGSTFQRKK 374
            :|.:.:..|.|  :|..:|:.|.:.|.||..|..|..||:.|.       |      ||..::.|
plant    20 MLLSGIGEHDGRKKRVFRCKTCERDFDSFQALGGHRASHSKLTNSDDKSLP------GSPKKKPK 78

  Fly   375 ALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHMRSH--DPARVKGAVKPLPQSVTIEVIEGKSP 437
            ..       :....:.|.:||..|.....|..|||.|  :..|.|.:        .:.|.....|
plant    79 TT-------TTTTAHTCPICGLEFPMGQALGGHMRKHRNEKEREKAS--------NVLVTHSFMP 128

  Fly   438 PTTTIT 443
            .|||:|
plant   129 ETTTVT 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368
C2H2 Zn finger 251..271 CDD:275368
COG5048 <256..415 CDD:227381 27/106 (25%)
zf-H2C2_2 263..288 CDD:290200
C2H2 Zn finger 279..327 CDD:275368 1/7 (14%)
zf-H2C2_2 320..342 CDD:290200 6/23 (26%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 3/19 (16%)
zf-C2H2 389..411 CDD:278523 8/21 (38%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)
AT3G46070NP_190193.1 zf-C2H2_6 35..60 CDD:372808 9/24 (38%)
zf-C2H2_6 85..109 CDD:372808 8/23 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.