DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and ZF2

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001118663.1 Gene:ZF2 / 821495 AraportID:AT3G19580 Length:273 Species:Arabidopsis thaliana


Alignment Length:297 Identity:65/297 - (21%)
Similarity:95/297 - (31%) Gaps:97/297 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 TLVETREDLLD----IELDWTGGEQSEHNETHEEEEGESDDDDTKDSNDTKDM-----LFQC--- 174
            |.:||:|||::    || .|...::|:...:|......|....::..:..:|:     |..|   
plant    14 TRIETKEDLMNDAVFIE-PWLKRKRSKRQRSHSPSSSSSSPPRSRPKSQNQDLTEEEYLALCLLM 77

  Fly   175 ---DQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTE 236
               ||           .|..|. |.::.  ||......:|..        ||||  .|.:.|.:.
plant    78 LAKDQ-----------PSQTRF-HQQSQ--SLTPPPESKNLP--------YKCN--VCEKAFPSY 118

  Fly   237 RDLRGHRWKH-------TGIFCDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSS 294
            :.|.||:..|       .....|....|........:|....|| |.|:|..|...|.|.:.|..
plant   119 QALGGHKASHRIKPPTVISTTADDSTAPTISIVAGEKHPIAASG-KIHECSICHKVFPTGQALGG 182

  Fly   295 H------------------SICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKA 341
            |                  ||.|:|.:              ....:..|.|.|            
plant   183 HKRCHYEGNLGGGGGGGSKSISHSGSV--------------SSTVSEERSHRG------------ 221

  Fly   342 FYSFHDLNVHAVSHTNL--RPFVCDVCGSTFQRKKAL 376
               |.|||:.|:...:|  .|.|.:...|....||.|
plant   222 ---FIDLNLPALPELSLHHNPIVDEEILSPLTGKKPL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 3/19 (16%)
COG5048 <256..415 CDD:227381 31/141 (22%)
zf-H2C2_2 263..288 CDD:290200 8/24 (33%)
C2H2 Zn finger 279..327 CDD:275368 11/65 (17%)
zf-H2C2_2 320..342 CDD:290200 3/21 (14%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 4/14 (29%)
zf-C2H2 389..411 CDD:278523
C2H2 Zn finger 391..411 CDD:275368
ZF2NP_001118663.1 zf-C2H2_6 106..131 CDD:404748 10/26 (38%)
C2H2 Zn finger 108..128 CDD:275368 7/21 (33%)
zf-C2H2_6 164..189 CDD:404748 7/24 (29%)
C2H2 Zn finger 167..187 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.