DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18262 and ZAT11

DIOPT Version :9

Sequence 1:	NP_572453.1	Gene:	CG18262 / 31745	FlyBaseID:	FBgn0030012	Length:	469	Species:	Drosophila melanogaster
Sequence 2:	NP_181279.1	Gene:	ZAT11 / 818319	AraportID:	AT2G37430	Length:	178	Species:	Arabidopsis thaliana

Alignment Length:	143	Identity:	37/143 - (25%)
Similarity:	57/143 - (39%)	Gaps:	36/143 - (25%)

- Green bases have known domain annotations that are detailed below.

  Fly   320 LTAHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRK---------KA 375
            |..|...||..: .:|:.|.|.|.||..|..|..||.  :|.:      |.::|         |.
plant    35 LNQHTESHTSNQ-FECKTCNKRFSSFQALGGHRASHK--KPKL------TVEQKDVKHLSNDYKG 90

  Fly   376 LRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHMRSHDPARVKGAVKP---LPQSVTIEVIEGKSP 437
            ...||          |.:|.::|.....|..|||.|   |....|:|   .|...::.|:  |..
plant    91 NHFHK----------CSICSQSFGTGQALGGHMRRH---RSSMTVEPSFISPMIPSMPVL--KRC 140

  Fly   438 PTTTITMAIDLNV 450
            .::...:::|||:
plant   141 GSSKRILSLDLNL 153

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18262	NP_572453.1	C2H2 Zn finger	224..246	CDD:275368
		C2H2 Zn finger	251..271	CDD:275368
		COG5048	<256..415	CDD:227381	28/103 (27%)
		zf-H2C2_2	263..288	CDD:290200
		C2H2 Zn finger	279..327	CDD:275368	2/6 (33%)
		zf-H2C2_2	320..342	CDD:290200	7/21 (33%)
		C2H2 Zn finger	335..355	CDD:275368	8/19 (42%)
		C2H2 Zn finger	363..383	CDD:275368	5/28 (18%)
		zf-C2H2	389..411	CDD:278523	7/21 (33%)
		C2H2 Zn finger	391..411	CDD:275368	7/19 (37%)
ZAT11	NP_181279.1	zf-C2H2_6	47..72	CDD:404748	10/26 (38%)
		C2H2 Zn finger	49..69	CDD:275368	8/19 (42%)
		zf-C2H2_6	94..119	CDD:404748	11/37 (30%)
		C2H2 Zn finger	96..116	CDD:275368	7/19 (37%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910