DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG18262 and AT2G28710

DIOPT Version :9

Sequence 1:	NP_572453.1	Gene:	CG18262 / 31745	FlyBaseID:	FBgn0030012	Length:	469	Species:	Drosophila melanogaster
Sequence 2:	NP_180439.1	Gene:	AT2G28710 / 817420	AraportID:	AT2G28710	Length:	156	Species:	Arabidopsis thaliana

Alignment Length:	145	Identity:	40/145 - (27%)
Similarity:	51/145 - (35%)	Gaps:	45/145 - (31%)

- Green bases have known domain annotations that are detailed below.

  Fly   322 AHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQ 386
            || :..|..|...|:.|.|.|.||..|..|..||               :|..||..| ...|.:
plant    24 AH-QNDTKSRVFACKTCNKEFPSFQALGGHRASH---------------RRSAALEGH-APPSPK 71

  Fly   387 R----KYACKLCGKTFAQSGGLNAHMRSHDPARVKGAVKPLPQSVTIEVIEGKSPPTTTITM--- 444
            |    |:.|.:||..||....|..|||.|......|..:.|            :|.|..:||
plant    72 RVKPVKHECPICGAEFAVGQALGGHMRKHRGGSGGGGGRSL------------APATAPVTMKKS 124

  Fly   445 ---------AIDLNV 450
                     .:|||:
plant   125 GGGNGKRVLCLDLNL 139

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG18262	NP_572453.1	C2H2 Zn finger	224..246	CDD:275368
		C2H2 Zn finger	251..271	CDD:275368
		COG5048	<256..415	CDD:227381	31/96 (32%)
		zf-H2C2_2	263..288	CDD:290200
		C2H2 Zn finger	279..327	CDD:275368	2/4 (50%)
		zf-H2C2_2	320..342	CDD:290200	7/19 (37%)
		C2H2 Zn finger	335..355	CDD:275368	8/19 (42%)
		C2H2 Zn finger	363..383	CDD:275368	4/19 (21%)
		zf-C2H2	389..411	CDD:278523	9/21 (43%)
		C2H2 Zn finger	391..411	CDD:275368	9/19 (47%)
AT2G28710	NP_180439.1	zf-C2H2_6	33..59	CDD:404748	10/40 (25%)
AT2G28710	NP_180439.1	zf-C2H2_6	78..100	CDD:404748	9/21 (43%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910