DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and ZNF630

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001032824.2 Gene:ZNF630 / 57232 HGNCID:28855 Length:657 Species:Homo sapiens


Alignment Length:537 Identity:132/537 - (24%)
Similarity:195/537 - (36%) Gaps:137/537 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 PDVAGGYHN---LRCGEVLFSAPASYEVSCLLCDQRLPLDGYPEH------FRLKHFTNSSSSLC 63
            ||...|..:   :..||:||              ||..|:..|:.      .::.|..|......
Human    79 PDRVKGLESSQQIISGELLF--------------QREILERAPKDNSLYSVLKIWHIDNQMDRYQ 129

  Fly    64 SNELESDPIAQDVVEVQGNEELHEELAKEAS---------PDL----------EEEEEEKEEGSK 109
            .|:   |.:.:.|. |...|.|.:|:..:.|         .||          :..|...:..|.
Human   130 GNQ---DRVLRQVT-VISRETLTDEMGSKYSAFGKMFNRCTDLAPLSQKFHKFDSCENSLKSNSD 190

  Fly   110 RQHYQRAAAMKNTL----------------VETREDLLDIELDWTGGEQSEHNETHEEEEGESDD 158
            ..:|.|:.|.||..                |..:|..:...::..|..|.|...:|::...:...
Human   191 LLNYNRSYARKNPTKRFRCGRPPKYNASCSVPEKEGFIHTGMEPYGDSQCEKVLSHKQAHVQYKK 255

  Fly   159 DDTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEAN--GGSLDKSASERN---------- 211
            ...::..:.      |..|.:|:..|..|..|:|:...|..  .|...|:.||::          
Human   256 FQAREKPNV------CSMCGKAFIKKSQLIIHQRIHTGEKPYVCGDCRKAFSEKSHLIVHQRIHT 314

  Fly   212 ------------SKKRKGP----------PKVYKCNE--------------------------EA 228
                        :..||.|          .|.|:|.|                          ..
Human   315 GEKPYECTKYGRAFSRKSPFTVHQRVHTGEKPYECFECPKAFSQKSHLIIHQRVHTREKPFECSE 379

  Fly   229 CNQTFRTERDLRGHRWKHTG---IFCDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDATFYTQK 290
            |.:.|.....|..|:..|||   ..|..|||.|.:...::.|::.|:|.||:||.||..||..|.
Human   380 CRKAFCEMSHLFIHQITHTGKKPYECTECGKTFPRKTQLIIHQRTHTGEKPYKCGECGKTFCQQS 444

  Fly   291 ELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSH 355
            .|..|...|||..|.:|..||:....:..||.|.|.||||:|..|..|||:|.....|.:|...|
Human   445 HLIGHQRIHTGEKPYVCTDCGKAFSQKSHLTGHQRLHTGEKPYMCTECGKSFSQKSPLIIHQRIH 509

  Fly   356 TNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHMRSHDPARVKGAV 420
            |..:|:.|..||.||.:|..|.:|..:|:.::.|.|..||:.|:....|..|.|.|.      ..
Human   510 TGEKPYQCGECGKTFSQKSLLIIHLRVHTGEKPYECTECGRAFSLKSHLILHQRGHT------GE 568

  Fly   421 KPLPQSVTIEVIEGKSP 437
            ||...|...:...||||
Human   569 KPYECSECGKAFCGKSP 585

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/47 (13%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
COG5048 <256..415 CDD:227381 60/158 (38%)
zf-H2C2_2 263..288 CDD:290200 11/24 (46%)
C2H2 Zn finger 279..327 CDD:275368 19/47 (40%)
zf-H2C2_2 320..342 CDD:290200 13/21 (62%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-C2H2 389..411 CDD:278523 8/21 (38%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
ZNF630NP_001032824.2 KRAB 8..68 CDD:214630
KRAB 8..47 CDD:279668
C2H2 Zn finger 238..257 CDD:275368 3/18 (17%)
C2H2 Zn finger 265..285 CDD:275368 7/19 (37%)
C2H2 Zn finger 293..313 CDD:275368 4/19 (21%)
zf-H2C2_2 305..330 CDD:290200 0/24 (0%)
C2H2 Zn finger 321..341 CDD:275368 3/19 (16%)
COG5048 <329..578 CDD:227381 80/254 (31%)
zf-H2C2_2 336..358 CDD:290200 4/21 (19%)
C2H2 Zn finger 349..369 CDD:275368 2/19 (11%)
C2H2 Zn finger 377..397 CDD:275368 4/19 (21%)
zf-H2C2_2 389..412 CDD:290200 9/22 (41%)
C2H2 Zn finger 405..425 CDD:275368 6/19 (32%)
zf-H2C2_2 418..440 CDD:290200 9/21 (43%)
C2H2 Zn finger 433..453 CDD:275368 8/19 (42%)
zf-H2C2_2 449..470 CDD:290200 8/20 (40%)
C2H2 Zn finger 461..481 CDD:275368 7/19 (37%)
zf-H2C2_2 473..498 CDD:290200 14/24 (58%)
C2H2 Zn finger 489..509 CDD:275368 7/19 (37%)
zf-H2C2_2 502..526 CDD:290200 10/23 (43%)
C2H2 Zn finger 517..537 CDD:275368 8/19 (42%)
zf-H2C2_2 530..553 CDD:290200 7/22 (32%)
C2H2 Zn finger 545..565 CDD:275368 7/19 (37%)
zf-H2C2_2 557..580 CDD:290200 7/28 (25%)
C2H2 Zn finger 573..593 CDD:275368 5/13 (38%)
C2H2 Zn finger 601..620 CDD:275370
C2H2 Zn finger 629..646 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.