DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and sens

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_524818.1 Gene:sens / 45328 FlyBaseID:FBgn0002573 Length:541 Species:Drosophila melanogaster


Alignment Length:481 Identity:100/481 - (20%)
Similarity:174/481 - (36%) Gaps:177/481 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IKVQPPPDVAGGYHNLRC------------GEVLFSAPASYEVSCLLCDQRLPLDGY-------- 46
            :.|.|||..|   .||:.            |.:::| |||      :|::....:.|        
  Fly   180 LNVTPPPLSA---VNLKSSSTPQQQRQRSQGNIIWS-PAS------MCERSARREQYGLKMEEQG 234

  Fly    47 --PEH--------FRLKHFTNSSSSLCS-------------NELESDPIAQD---------VVEV 79
              .||        |:.:..|.|.|||.|             .:||.: :||.         :..:
  Fly   235 DEEEHQVDPIVRKFKYERRTASISSLQSPISSLSAPASNAVQDLEFE-VAQQQLYAHRSAFMAGL 298

  Fly    80 QGN--EELHEELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNTLVETREDLLDIELDWTGGEQ 142
            .||  |.|.:.|..::....:::::.:.:..::|..:.|||:.| ||...|         .|..:
  Fly   299 TGNNLELLTQHLKLKSEQPQQQQQQHRIKDEQQQDNRSAAALMN-LVAAAE---------FGYMR 353

  Fly   143 SEHNETHEEEEGESDDDDTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSA 207
            ::|.:..::::                        .:.::.::..|...:.:|.::....:.:.:
  Fly   354 NQHQQPQQQQQ------------------------QQLHHQQQPQQHQHQQQHPDSTATDVARRS 394

  Fly   208 SERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTGIFCDICGKPFTQSGNMMRHRQRHS 272
            |..:|.:.:        |||.     |:.|:.:          |..|||.|.:|..:..|...||
  Fly   395 SSSSSYQGE--------NEEK-----RSGRNFQ----------CKQCGKSFKRSSTLSTHLLIHS 436

  Fly   273 GIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEV 337
            ..:|:.|..|...|:.:.::..|:..                            ||||:|.||.|
  Fly   437 DTRPYPCQYCGKRFHQKSDMKKHTYI----------------------------HTGEKPHKCTV 473

  Fly   338 CGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSG 402
            |.|||....:|..|...||..:||.|.:|..:||||..||.|:    |.|               
  Fly   474 CLKAFSQSSNLITHMRKHTGYKPFGCHLCDQSFQRKVDLRRHR----ESR--------------- 519

  Fly   403 GLNAHMRSHDPARVKGAVKPLPQSVT 428
                    |:.|.....:|||...|:
  Fly   520 --------HEEAPPVEDLKPLKMEVS 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 41/158 (26%)
zf-H2C2_2 263..288 CDD:290200 7/24 (29%)
C2H2 Zn finger 279..327 CDD:275368 4/47 (9%)
zf-H2C2_2 320..342 CDD:290200 10/21 (48%)
C2H2 Zn finger 335..355 CDD:275368 8/19 (42%)
C2H2 Zn finger 363..383 CDD:275368 9/19 (47%)
zf-C2H2 389..411 CDD:278523 0/21 (0%)
C2H2 Zn finger 391..411 CDD:275368 0/19 (0%)
sensNP_524818.1 zf-C2H2 413..435 CDD:278523 7/31 (23%)
C2H2 Zn finger 415..435 CDD:275368 7/19 (37%)
COG5048 423..>497 CDD:227381 25/101 (25%)
zf-H2C2_2 428..452 CDD:290200 7/23 (30%)
C2H2 Zn finger 443..463 CDD:275368 4/47 (9%)
zf-H2C2_2 455..480 CDD:290200 13/52 (25%)
C2H2 Zn finger 471..491 CDD:275368 8/19 (42%)
C2H2 Zn finger 499..516 CDD:275368 8/16 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.