DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG31365

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_732827.1 Gene:CG31365 / 42736 FlyBaseID:FBgn0051365 Length:639 Species:Drosophila melanogaster


Alignment Length:496 Identity:105/496 - (21%)
Similarity:168/496 - (33%) Gaps:130/496 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 FSAPASYEVSCLLCDQRLPLDGYPEHFRLKHFTNSSSSLCSNELESDPIAQDVVEVQGNEELHEE 88
            |....:.|:...|...||.|       |.|..|.....| :.|:.|: :.:::.| :...::.::
  Fly   139 FKEEQAAEMHKRLVKSRLEL-------RAKLTTELRKEL-AEEVRSE-VRKELAE-EVRSQVRDD 193

  Fly    89 LAKEASPDLEEEE------------EEKEEG-----------SKRQHYQRAAAMKN---TLVETR 127
            |..|.|.|:.:|:            .||:.|           :|.|..:.|:..::   .|.:.|
  Fly   194 LRNEVSEDIRKEQLAMLLGELEVYLTEKKAGRWESLDGSEPETKPQVKEDASPSRSKTKALPKRR 258

  Fly   128 EDLLDIELDWTGGEQ------------------SEHN----ETHEEEEGESDDD----------- 159
            ..|:|..|..|...:                  |:.|    |..||...||.:|           
  Fly   259 PSLVDANLKATEARKDAKEEEFILGCNTDPANNSDVNIDGLELDEEVPAESGEDFREINMVGSDV 323

  Fly   160 --------------DTKDSNDTKDMLFQCDQCDRAYNTK------------------------RS 186
                          .::|.|......|..|....:||.|                        ..
  Fly   324 VHTDNGEIYIINSASSEDQNQDSTPEFDQDNGITSYNIKEDGEIQFSGEKPEEIEDVVVFNLGEE 388

  Fly   187 LQSHRRLKHSEANGGSLDKSASERNS----KKRKGPPKVYKCNEEACNQ--TFRTERDLRGHRWK 245
            :...:::.....|...::|..::|:.    |:::....|:| .|.:|.|  |.|....::..:  
  Fly   389 ISQEQQVFSFHENVIIVEKEQNDRDEQTPLKRKRSSELVFK-QESSCPQPKTGRITDTVKSFQ-- 450

  Fly   246 HTGIFCDICGKPFTQSGNMMRHRQRH-SGIKPH-----KCPECDATFYTQKELSSHSICHTGRMP 304
                 |.:|...|.....:.||...| .|:|..     |||.|.........|..|.|.|||..|
  Fly   451 -----CHLCPVAFPTQKLLTRHHNTHIKGLKSGKGGTLKCPSCALQLSCASSLKRHMIIHTGLKP 510

  Fly   305 CICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLNVH--AVSHTNLRPFVCDVCG 367
            ..|..|......|.||..||..|||.:..:|..|...|....:|..|  .|...|.|...|.:|.
  Fly   511 FKCSECELSFSQREVLKRHMDTHTGVKRHQCPQCSSCFAQKSNLQQHIGRVHMGNSRTHKCHLCH 575

  Fly   368 STFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHM 408
            .:|.....|..|.:.|:.. .::||.||:.|.....:..|:
  Fly   576 RSFNHVSGLSRHLVTHAGV-MFSCKQCGRQFNDRSAVQRHV 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/23 (22%)
C2H2 Zn finger 251..271 CDD:275368 5/19 (26%)
COG5048 <256..415 CDD:227381 47/161 (29%)
zf-H2C2_2 263..288 CDD:290200 9/30 (30%)
C2H2 Zn finger 279..327 CDD:275368 17/47 (36%)
zf-H2C2_2 320..342 CDD:290200 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 6/21 (29%)
C2H2 Zn finger 363..383 CDD:275368 5/19 (26%)
zf-C2H2 389..411 CDD:278523 6/20 (30%)
C2H2 Zn finger 391..411 CDD:275368 6/18 (33%)
CG31365NP_732827.1 zf-AD 13..86 CDD:214871
vATP-synt_E 109..>244 CDD:304907 23/114 (20%)
RRF <161..222 CDD:294170 12/63 (19%)
zf-C2H2_8 454..530 CDD:292531 23/75 (31%)
C2H2 Zn finger 485..505 CDD:275368 6/19 (32%)
zf-H2C2_2 497..522 CDD:290200 9/24 (38%)
C2H2 Zn finger 513..533 CDD:275368 7/19 (37%)
zf-H2C2_2 526..550 CDD:290200 9/23 (39%)
C2H2 Zn finger 541..562 CDD:275368 5/20 (25%)
C2H2 Zn finger 571..591 CDD:275368 5/19 (26%)
C2H2 Zn finger 598..617 CDD:275368 6/18 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.