DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG7691

DIOPT Version :10

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_650728.1 Gene:CG7691 / 42228 FlyBaseID:FBgn0038626 Length:283 Species:Drosophila melanogaster


Alignment Length:204 Identity:57/204 - (27%)
Similarity:79/204 - (38%) Gaps:30/204 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   183 TKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHT 247
            |:.||.|| .:...:..|.|.|.....||.      .||......|.::..||:...:|....:.
  Fly   102 TESSLLSH-TIWELKMPGESFDSIPKTRNG------IKVGIITVTAESKQTRTKLKRKGPILANV 159

  Fly   248 GIFCDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICE--VC 310
            .:..:|...|..|...|...|:........:|.:||..|.....|::|:..|||..|.:|.  .|
  Fly   160 TVPSNIVEIPPIQQRKMPEKRRLKRVGGQFECIDCDKKFDHSWMLTAHTRTHTGEKPFVCPDGSC 224

  Fly   311 GRPCRDRGVLTAHMR---RHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQR 372
            .:...||..|.:|.|   .|  |...:|..|||.|..|..||.|::          |.|     |
  Fly   225 RKAFSDRSNLRSHQRTMGHH--EWQHQCGQCGKYFSQFSYLNRHSL----------DAC-----R 272

  Fly   373 KKALRV-HK 380
            |..|.| ||
  Fly   273 KYLLSVMHK 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 COG5236 <222..>313 CDD:227561 21/92 (23%)
C2H2 Zn finger 224..246 CDD:275368 4/21 (19%)
C2H2 Zn finger 251..271 CDD:275368 5/19 (26%)
zf-H2C2_2 263..288 CDD:463886 6/24 (25%)
C2H2 Zn finger 279..327 CDD:275368 17/52 (33%)
zf-H2C2_2 320..342 CDD:463886 9/24 (38%)
C2H2 Zn finger 335..355 CDD:275368 9/19 (47%)
C2H2 Zn finger 363..383 CDD:275368 8/19 (42%)
zf-C2H2 389..411 CDD:395048
C2H2 Zn finger 391..411 CDD:275368
CG7691NP_650728.1 COG5048 188..>271 CDD:227381 29/94 (31%)
C2H2 Zn finger 191..211 CDD:275368 6/19 (32%)
C2H2 Zn finger 219..244 CDD:275368 7/24 (29%)
C2H2 Zn finger 250..266 CDD:275368 8/15 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.