DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG31388

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_650060.1 Gene:CG31388 / 41355 FlyBaseID:FBgn0051388 Length:446 Species:Drosophila melanogaster


Alignment Length:431 Identity:99/431 - (22%)
Similarity:155/431 - (35%) Gaps:146/431 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 AQDVVE-----VQGNEELHEELAKEASPDLEEE------------------EEEKEEGSKRQHYQ 114
            ||:::|     |:..||..|.||::...|..:|                  :.|.::    ::..
  Fly    71 AQELLELQLRQVEKEEEAFESLAEQWLDDCPDELSNLSPVLQLNDRMDFIFDPEPQD----KNTD 131

  Fly   115 RAAAMKNTLVETREDLLDI-----------ELDWTGGEQSEHNE--THEEEEGESDDDDTKDSN- 165
            ..|::|.|   |..:.::.           ||.......:||.:  ...|.|.||:..|.:|:: 
  Fly   132 ELASIKTT---TTTEYMNAYQSVASPQSSPELSTDSQLSNEHFDMGLSPESEPESEAIDNRDTSS 193

  Fly   166 -----------------------------DTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGG 201
                                         |||   |.||.||..:.:..:|..|..:.:.     
  Fly   194 SHTCSKCGLEFENVDELKLHKYHLHDIPPDTK---FVCDHCDEGFRSAAALTRHCNMINL----- 250

  Fly   202 SLDKSASERNSKKRKGPPKVYKCNEEACNQTFRT--------ERDLRGHRWKHTGIFCDICGKPF 258
                             |..:.|.:  |...|..        :|.||....:|.   |.||||..
  Fly   251 -----------------PLTHSCTK--CKSQFHNHILLETHKQRCLRPPASQHV---CHICGKHL 293

  Fly   259 TQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEV-CGRPCRDRGVLTA 322
            |.:.|:..|..||:|.:.|||.:|.|:|||..||.||...||...|.||.. ||:..|.....:.
  Fly   294 TTAFNLKNHLVRHAGTRRHKCDQCSASFYTAAELCSHQKTHTTERPYICRYNCGKTFRFCSARSM 358

  Fly   323 HMRRH--TGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSE 385
            |.|.|  ..:|..:||.|.|::               :.|..|             |.|:..|:.
  Fly   359 HERVHMDASKRIYQCEYCPKSY---------------VTPSEC-------------RTHQKYHNL 395

  Fly   386 QRKYACKLCGKTFAQSGGLNAHMRSHD----PARVKGAVKP 422
            .|.:.|::|..:|..:....:|::|:.    .||.|.|..|
  Fly   396 TRDHGCEICRISFKTAKHYRSHLKSNAHKTLEARAKAAASP 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/29 (21%)
C2H2 Zn finger 251..271 CDD:275368 8/19 (42%)
COG5048 <256..415 CDD:227381 46/165 (28%)
zf-H2C2_2 263..288 CDD:290200 11/24 (46%)
C2H2 Zn finger 279..327 CDD:275368 20/48 (42%)
zf-H2C2_2 320..342 CDD:290200 8/23 (35%)
C2H2 Zn finger 335..355 CDD:275368 4/19 (21%)
C2H2 Zn finger 363..383 CDD:275368 3/19 (16%)
zf-C2H2 389..411 CDD:278523 4/21 (19%)
C2H2 Zn finger 391..411 CDD:275368 4/19 (21%)
CG31388NP_650060.1 zf-AD 4..76 CDD:285071 2/4 (50%)
C2H2 Zn finger 228..254 CDD:275368 7/47 (15%)
C2H2 Zn finger 286..306 CDD:275368 8/19 (42%)
C2H2 Zn finger 314..334 CDD:275368 10/19 (53%)
C2H2 Zn finger 342..363 CDD:275368 6/20 (30%)
C2H2 Zn finger 373..393 CDD:275368 8/47 (17%)
C2H2 Zn finger 401..419 CDD:275368 4/17 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.