DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and topi

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_649945.1 Gene:topi / 41199 FlyBaseID:FBgn0037751 Length:814 Species:Drosophila melanogaster


Alignment Length:471 Identity:109/471 - (23%)
Similarity:167/471 - (35%) Gaps:150/471 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QPPPDVAGGYHNL----RCGEVLFSAPASY--------------------------EVSCLLCDQ 39
            ||....|.|.|.:    .||.:.:....::                          :.:.||.|.
  Fly   262 QPHTIPAAGLHVVVKCNSCGRIFYDPQVAFRHGLIHDSEHSTMRQSPMTQVPSNRADFNELLLDG 326

  Fly    40 RLPLDGYPEHFRLKHFTNSSSSLCSNELESDPIAQDVVEVQGNEELHEELAKEASPDLEEEEEEK 104
            .:.:|..|....    :|.:::....|:.|..|...|::.:..|.:..::|:..........|.:
  Fly   327 EMLIDNDPAFAT----SNQNTNPPKKEMFSSLILGSVLQCEFCEYIFADIAELLVHSASHVAERR 387

  Fly   105 EEGSKRQHYQRAAAMKNTLVETREDLLDIELDWTGGEQSEHNETHEEEEGESDD-----DDTKDS 164
            .|.:                     ..||::: |..|.|.|.:|         |     :..:..
  Fly   388 FECT---------------------ACDIQMN-TAKEASIHFQT---------DCIFMREAIRSL 421

  Fly   165 NDTKDMLFQCDQCDRAYNTKRSLQSHR--------RLKHSEANGGSLDKSASERNSKKRKGPPKV 221
            |.|....|.|:.|:..:.....||.||        ||               ..|.||...|   
  Fly   422 NVTLSRYFVCNVCELKFANTDLLQEHRCTSFHYFPRL---------------NENGKKLLLP--- 468

  Fly   222 YKCNEEACNQTFRTERDLRGH-------------RWKHTG------IFCDICGKPFTQSGNMMRH 267
              |  :.|:..|....|...|             ..::||      ..||||||.:|||.::.:|
  Fly   469 --C--DFCDVNFEFAHDFLAHSEEKHLNKKKREKETRNTGAGRIRQYLCDICGKSYTQSSHLWQH 529

  Fly   268 RQRHSGIKPHKCPE--CDATFYTQKELSSH-SICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTG 329
            .:.|.|:||..|.|  ||..|..:.:|:.| ..||||..|.:|.|||:......|...|...|.|
  Fly   530 LRFHQGVKPFVCQEENCDRKFTIRPDLNDHIRKCHTGERPYLCLVCGKRFLTGSVFYQHRLIHRG 594

  Fly   330 ERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLC 394
            ||..:||.|||.||                            |..||:.|:.:|:.::.|:|..|
  Fly   595 ERRYECEECGKRFY----------------------------RADALKNHQRIHTGEKPYSCLFC 631

  Fly   395 GKTFAQSGGLNAHMRS 410
            .|||.|.|..:.|:|:
  Fly   632 TKTFRQRGDRDKHIRA 647

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/34 (15%)
C2H2 Zn finger 251..271 CDD:275368 10/19 (53%)
COG5048 <256..415 CDD:227381 53/158 (34%)
zf-H2C2_2 263..288 CDD:290200 10/26 (38%)
C2H2 Zn finger 279..327 CDD:275368 18/50 (36%)
zf-H2C2_2 320..342 CDD:290200 10/21 (48%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 4/19 (21%)
zf-C2H2 389..411 CDD:278523 10/22 (45%)
C2H2 Zn finger 391..411 CDD:275368 9/20 (45%)
topiNP_649945.1 C2H2 Zn finger 230..250 CDD:275368
C2H2 Zn finger 277..297 CDD:275368 2/19 (11%)
C2H2 Zn finger 431..453 CDD:275368 6/21 (29%)
COG5048 <450..647 CDD:227381 70/246 (28%)
C2H2 Zn finger 469..490 CDD:275368 5/22 (23%)
zf-C2H2 511..533 CDD:278523 10/21 (48%)
C2H2 Zn finger 513..564 CDD:275368 21/50 (42%)
C2H2 Zn finger 541..561 CDD:275368 7/19 (37%)
zf-H2C2_2 555..581 CDD:290200 11/25 (44%)
C2H2 Zn finger 572..592 CDD:275368 6/19 (32%)
zf-H2C2_2 585..609 CDD:290200 12/51 (24%)
zf-C2H2 598..620 CDD:278523 11/49 (22%)
C2H2 Zn finger 600..620 CDD:275368 11/47 (23%)
zf-H2C2_2 612..637 CDD:290200 10/24 (42%)
C2H2 Zn finger 628..646 CDD:275368 8/17 (47%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446621
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.