DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG7963

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_649798.3 Gene:CG7963 / 41001 FlyBaseID:FBgn0037584 Length:354 Species:Drosophila melanogaster


Alignment Length:415 Identity:87/415 - (20%)
Similarity:149/415 - (35%) Gaps:93/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 APASYEVSCLLCDQRLPLDGYPEHFRLKHFTNSSSSLCSNELESDPIAQDVVEVQGNEELHEELA 90
            :|.|.|..|.:|                             |:.|.:..|:.|:.  ||:..:|.
  Fly     2 SPPSGEFRCRVC-----------------------------LKQDELLVDIYEIV--EEMQVDLC 35

  Fly    91 K--EASPDLEEEEEEKEEGSKRQHYQR----AAAMKNTLVET---REDLLDIELDWTGGEQSEH- 145
            .  |....::.:..:.:.....|....    ||..:...||:   |:...:|.:|......||. 
  Fly    36 TLLETCGGIKVDRRDVQPMYLCQECTNELLIAAKFRKICVESEKLRDMAPEINIDTAEPLASEEI 100

  Fly   146 ----NETHEEEEGESDDDDTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKS 206
                ...:.|:....:|.:.:....::   :.|..|...:.....|:.|.:..|:...  .:|..
  Fly   101 IIIDPSDYIEQLSAVEDPENEPIGVSR---WNCQHCGAGFQLSEVLRRHIQEVHASIT--IIDCR 160

  Fly   207 ASER-----------NSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTG---IFCDICGKP 257
            ...|           |....|.|.:.:||.|  |.:..::...|..|...||.   ..||.|.|.
  Fly   161 ERRRIFTKLGCYQVHNCSYAKTPKRGHKCLE--CGKCLQSASSLASHIRLHTDEWPFTCDQCAKA 223

  Fly   258 FTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTA 322
            |..:|.:..|::||..:..|||..|...|.....|..|.:                         
  Fly   224 FRTNGALEVHQRRHKQVLQHKCLHCGRGFVESSNLRRHIV------------------------- 263

  Fly   323 HMRRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQR 387
              .|||.|||..|.|..::|...:.|.:|..::|..||:.|......|.:...|::|:.:|:.:|
  Fly   264 --NRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRDKRFAQLGVLKIHERIHTGER 326

  Fly   388 KYACKLCGKTFAQSGGLNAHMRSHD 412
            .:.|::|.|.|.::|.|..|...|:
  Fly   327 LHRCQVCEKPFTRAGQLRKHALRHE 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 41/157 (26%)
zf-H2C2_2 263..288 CDD:290200 8/24 (33%)
C2H2 Zn finger 279..327 CDD:275368 5/47 (11%)
zf-H2C2_2 320..342 CDD:290200 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 5/19 (26%)
C2H2 Zn finger 363..383 CDD:275368 4/19 (21%)
zf-C2H2 389..411 CDD:278523 7/21 (33%)
C2H2 Zn finger 391..411 CDD:275368 7/19 (37%)
CG7963NP_649798.3 zf-AD 10..80 CDD:285071 15/100 (15%)
C2H2 Zn finger 159..179 CDD:275368 2/19 (11%)
COG5048 184..>250 CDD:227381 21/67 (31%)
C2H2 Zn finger 189..209 CDD:275368 5/21 (24%)
C2H2 Zn finger 217..237 CDD:275368 7/19 (37%)
C2H2 Zn finger 245..262 CDD:275368 4/16 (25%)
C2H2 Zn finger 274..294 CDD:275368 5/19 (26%)
C2H2 Zn finger 302..322 CDD:275368 4/19 (21%)
zf-H2C2_2 315..339 CDD:290200 8/23 (35%)
C2H2 Zn finger 330..350 CDD:275368 7/19 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BQ0F
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.