DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG11247

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001097659.1 Gene:CG11247 / 40414 FlyBaseID:FBgn0037120 Length:522 Species:Drosophila melanogaster


Alignment Length:314 Identity:90/314 - (28%)
Similarity:133/314 - (42%) Gaps:37/314 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 KNTLVETREDLLDIELDWTGGEQSEHNETHEEEEGESDDDD---------TKDSNDTKDMLFQCD 175
            |::|...|:..:|.|.| .||||            :|.|||         .:.....|.....|.
  Fly    45 KSSLASLRDACVDEEED-DGGEQ------------DSKDDDYVQPQLKKSARKGEPVKRKHHVCS 96

  Fly   176 QCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKG-------PPKVYKCNEEACNQTF 233
            ||.:.:..|..||.|..:...|......|...|.|.:...|.       ..|.:.|::  |.::|
  Fly    97 QCSKEFGGKTDLQRHMLIHSDERPHKCKDCGKSYRQAVNLKNHITTAHEHRKQFVCSQ--CPKSF 159

  Fly   234 RTERDLRGHRWKHTG---IFCDICGKPFTQSGNMMRHRQRH--SGIKPHKCPECDATFYTQKELS 293
            ..:..||.|...|:|   ..||:|.|.|.:.|.:.:|...|  :.|:...|.:|.|:|.|...|.
  Fly   160 ALKERLRLHMRLHSGEKPYPCDLCDKKFARGGQLQQHMVSHHKTSIQQFNCTKCSASFSTNANLR 224

  Fly   294 SHSICHTGRMPCICEVCGRPCRDRGVLTAHM-RRHTGERPAKCEVCGKAFYSFHDLNVHAVSHTN 357
            .|...|...|...|.:|.....:...|.||: :.|......:||:|.|......||..|...||.
  Fly   225 VHMERHEQGMEHRCSICENQFANELALRAHINQEHHKLTQFECEICHKMIEPDEDLATHMQRHTA 289

  Fly   358 LRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHMRSH 411
            ::..||:||.:.|.:|....||..:|:.:|.|.|::|.:|||.|..|..|:|.|
  Fly   290 VKTHVCEVCNTYFTQKSQYNVHMRMHTGERPYQCRICHQTFAHSSVLKLHIRKH 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 6/21 (29%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 51/159 (32%)
zf-H2C2_2 263..288 CDD:290200 7/26 (27%)
C2H2 Zn finger 279..327 CDD:275368 14/48 (29%)
zf-H2C2_2 320..342 CDD:290200 8/22 (36%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-C2H2 389..411 CDD:278523 10/21 (48%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
CG11247NP_001097659.1 COG5048 <88..247 CDD:227381 42/160 (26%)
C2H2 Zn finger 95..115 CDD:275368 7/19 (37%)
zf-H2C2_2 107..132 CDD:290200 6/24 (25%)
C2H2 Zn finger 123..144 CDD:275368 4/20 (20%)
C2H2 Zn finger 152..172 CDD:275368 6/21 (29%)
zf-H2C2_2 165..189 CDD:290200 10/23 (43%)
C2H2 Zn finger 180..200 CDD:275368 7/19 (37%)
COG5048 <192..369 CDD:227381 48/152 (32%)
C2H2 Zn finger 210..230 CDD:275370 7/19 (37%)
C2H2 Zn finger 238..260 CDD:275371 5/21 (24%)
C2H2 Zn finger 267..287 CDD:275368 7/19 (37%)
C2H2 Zn finger 295..315 CDD:275368 7/19 (37%)
zf-H2C2_2 309..332 CDD:290200 9/22 (41%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
C2H2 Zn finger 351..374 CDD:275368
C2H2 Zn finger 382..399 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446627
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.