DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG7386

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_648036.1 Gene:CG7386 / 38719 FlyBaseID:FBgn0035691 Length:662 Species:Drosophila melanogaster


Alignment Length:488 Identity:115/488 - (23%)
Similarity:180/488 - (36%) Gaps:123/488 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GEVLFSAPASYEV--SCLL--CDQRLPLDGYPEHF-----------------------RLKHFTN 57
            |..||..|..::.  :|..  .||.   ||:|.:.                       |||....
  Fly    23 GHDLFVVPDLFQKLRACTSFDADQN---DGFPRNLCTQCFTKLNDLHDFRELCAESIKRLKEMMT 84

  Fly    58 SSSSLCSNELES-----------------DPIAQDVVEVQGNEELHEELAKEASPDLEEEEEEKE 105
            |..::.....||                 ||:..:.:|:..|||...:|.::...:|||...::.
  Fly    85 SQRNMPMGVFESIADDSEAPERPEEPASFDPLLNNKLEMIDNEEDVFKLLEKVDKELEEHSRDQS 149

  Fly   106 EGSKRQHYQRAAAMKNTLVETREDLLDIELDWTGGEQSEHN---ETHEEEEGESDDDD-----TK 162
            |    :|:..|                           |||   |..:|.||.:.||:     .:
  Fly   150 E----EHFSSA---------------------------EHNGLEEEKKESEGFNSDDEQAMGQRR 183

  Fly   163 DSNDTKDM--LFQCDQCDRAYNTKRSLQSHRRLKHSE----------------ANGGSLDKSASE 209
            .:||.:.:  |..|..|.:.:..:...:.|  :||..                ...|:|......
  Fly   184 IANDKRKLFRLMSCSICQQKFKKQSKFEEH--MKHHNDLLPFQCQEESCRKGFTTAGALRLHVDY 246

  Fly   210 RNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWK-HTGI---------FCDICGKPFTQSGNM 264
            .:|||....|    |..|.|...|...|.|..|..| |...         .|..||..|.....|
  Fly   247 AHSKKEDTVP----CTVEGCQLVFSRLRLLTIHLKKVHNQARVIAPRGEQSCKECGVVFRCPVAM 307

  Fly   265 MRHRQRHSGIK-PHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHT 328
            .:|...|:|.: |:.|..|...||....|.:|.:.|.|....:|:.||.....|...:.|:..||
  Fly   308 KKHMYTHTGEELPYPCTICGKGFYINSALKNHLLRHAGIKNYVCQYCGVRKTTRQEWSKHILIHT 372

  Fly   329 GERPAKCEVCGKAFYSFHDLNVHA-VSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACK 392
            .....||.:|..|.::...|..|. :.|..:|.|.|..||.||.:..|.::|::.|:.:::..||
  Fly   373 QRNQFKCRICDYATHTKRVLESHVKIVHEKIRNFACQYCGKTFGKAYACKIHEMAHTGEKRCECK 437

  Fly   393 LCGKTFAQSGGLNAHMRSHDPARVKGAVKPLPQ 425
            :|.|.|..|..||.|::.|:.: |:.|::...|
  Fly   438 VCDKKFLHSESLNNHLKIHEKS-VERALETYKQ 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 8/22 (36%)
C2H2 Zn finger 251..271 CDD:275368 6/19 (32%)
COG5048 <256..415 CDD:227381 48/160 (30%)
zf-H2C2_2 263..288 CDD:290200 8/25 (32%)
C2H2 Zn finger 279..327 CDD:275368 13/47 (28%)
zf-H2C2_2 320..342 CDD:290200 6/21 (29%)
C2H2 Zn finger 335..355 CDD:275368 5/20 (25%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-C2H2 389..411 CDD:278523 9/21 (43%)
C2H2 Zn finger 391..411 CDD:275368 9/19 (47%)
CG7386NP_648036.1 zf-AD 10..81 CDD:214871 12/60 (20%)
C2H2 Zn finger 197..217 CDD:275368 4/21 (19%)
C2H2 Zn finger 294..314 CDD:275368 6/19 (32%)
C2H2 Zn finger 323..343 CDD:275368 6/19 (32%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
C2H2 Zn finger 379..400 CDD:275368 5/20 (25%)
C2H2 Zn finger 408..428 CDD:275368 7/19 (37%)
C2H2 Zn finger 436..456 CDD:275368 9/19 (47%)
C2H2 Zn finger 534..555 CDD:275368
C2H2 Zn finger 563..583 CDD:275368
zf-H2C2_2 575..600 CDD:290200
C2H2 Zn finger 591..611 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449743
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.