DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG30431

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:456 Identity:108/456 - (23%)
Similarity:164/456 - (35%) Gaps:117/456 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 YHNLRCGEVLFSAP----ASYEVSCLLCDQRLPLDGYPEHFRLKHFTNSSSSLCSNELESDPIAQ 74
            :|.|.|...|...|    :.|:.|..|.   :.|.......||:|..|.:..:|...|.....|:
  Fly     7 HHPLVCRCCLLEQPPLYHSLYDASSQLA---VELKALAPALRLEHGDNLTDVICDLCLRRLHDAR 68

  Fly    75 D----------VVEVQGNEELH-----EELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNT-- 122
            |          |:.::.....|     :.||.:...:..|.|....||......|.:..:.:.  
  Fly    69 DFQRRCEHSEQVLRMRHEHWKHTVAVGDALALDDVLECLEREVGSLEGPMSVPLQASKPVAHVAP 133

  Fly   123 LVETREDLLDIE-LDWTGGEQSEH---------------NETHEEEE------------GESDDD 159
            |:||    :|.| ||:.....|||               |..|.:.|            .||.::
  Fly   134 LMET----VDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEE 194

  Fly   160 DTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKC 224
            ...|:.:...|                    ||.:..:.|     ....||.:.....|..::.|
  Fly   195 PAPDAAEKPKM--------------------RRARPRQDN-----VKPKERKASGAVHPRSLHPC 234

  Fly   225 NEEACNQTFRTERDLRGHRWKHTGIFCDICGKPFTQSGNMMRHRQRHSGI--KPHKCPECDATFY 287
            .|                           |.|.||::..:..|.....|:  ..::|.||...|.
  Fly   235 PE---------------------------CEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFA 272

  Fly   288 TQKELSSH-SICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGE---RPAKCEVCGKAFYSFHDL 348
            ::..|..| ...|:...|..|:.|.|....|..|.:|:|.||||   |..:|:.|.|::.:..||
  Fly   273 SRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDL 337

  Fly   349 NVHAVSHT-NL-RPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHM-RS 410
            ..|..||. |: |||.||.|...|..:..|..|.|:|:.::.:||:.|.|.:...|.||.|| |.
  Fly   338 RTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRL 402

  Fly   411 H 411
            |
  Fly   403 H 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 2/21 (10%)
C2H2 Zn finger 251..271 CDD:275368 5/19 (26%)
COG5048 <256..415 CDD:227381 56/165 (34%)
zf-H2C2_2 263..288 CDD:290200 6/26 (23%)
C2H2 Zn finger 279..327 CDD:275368 15/48 (31%)
zf-H2C2_2 320..342 CDD:290200 11/24 (46%)
C2H2 Zn finger 335..355 CDD:275368 6/19 (32%)
C2H2 Zn finger 363..383 CDD:275368 7/19 (37%)
zf-C2H2 389..411 CDD:278523 10/22 (45%)
C2H2 Zn finger 391..411 CDD:275368 9/20 (45%)
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 16/73 (22%)
C2H2 Zn finger 234..255 CDD:275368 7/47 (15%)
C2H2 Zn finger 264..285 CDD:275368 6/20 (30%)
C2H2 Zn finger 293..313 CDD:275368 7/19 (37%)
zf-C2H2_8 305..373 CDD:292531 26/67 (39%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 7/19 (37%)
zf-H2C2_2 366..389 CDD:290200 8/22 (36%)
C2H2 Zn finger 382..403 CDD:275368 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446623
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.