DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and Plzf

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:507 Identity:116/507 - (22%)
Similarity:178/507 - (35%) Gaps:159/507 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 CDQRLPLD-----GYPEHFRL----KHFTNSSSS-----------------LCSNELES--DPIA 73
            ||..|.||     ....||.:    ..|.||:..                 .|:..|.:  |...
  Fly    35 CDLLLELDSDDSLSLSVHFCVLAAQSQFINSNQKQQQFSIHNPLKITIRNFSCTQCLHTIVDFFY 99

  Fly    74 QDVVEVQGNEELH-EELAKEASPDLEEEEEEKEEGSKRQHYQRAAAMKNTLVETREDLLDIELDW 137
            :|:|.|....||| .|||:                              .|..|  :||::....
  Fly   100 EDLVSVSKEHELHFRELAQ------------------------------ILAVT--ELLNLYQLQ 132

  Fly   138 TGGEQSEHNETHEEEEGESDDDDTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGS 202
            ..||..|..|.....|.:.:.|..|.:    :.:|:            :.||:.:||        
  Fly   133 PLGEAKEATEIPAPGEAQPNPDPEKKA----EAVFE------------NRQSYFKLK-------- 173

  Fly   203 LDKSASERNSKKRKGPPKV-------YKCNE------------------EACNQTFRTERDLRGH 242
                    |.:..|...||       :||.:                  ..|...|...|:...|
  Fly   174 --------NPRAVKSSSKVNYCIGCDFKCYQVQKMIEHMGSCEPSHLICSLCEVGFLDWREYDTH 230

  Fly   243 RWKHTG-----IFCDICGKPFTQSGNMMRHRQRHSGIKPHKCPECDATFYTQKELSSHSICHTGR 302
            ..:|:|     .||..||..|.....::.|:.:||...||.||.|...|..::.||:|.:.|...
  Fly   231 LRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKGFKWKQGLSNHILVHNPE 295

  Fly   303 MPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEV--CGKAFYSFHDLNVHAVSHTNLRPFVCDV 365
            ...:|:|||........|.:|...||||..| |.|  |........:|.:|..:|...|.|:|:|
  Fly   296 KQMLCDVCGYSTTHMKALKSHKLLHTGEFFA-CTVSGCKHRANRKENLKLHIETHKQGRDFICEV 359

  Fly   366 CGSTFQRKKALRVHKLLHSEQ--RKYACKLCGKTFAQSGGLNAHMR---SHDPAR---------- 415
            ||..|.:.|.|:.|.|.|:|.  .:|.|:|||.:..:|..:..|::   :..|.:          
  Fly   360 CGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVHTEKPVQLELSETVDSS 424

  Fly   416 ---------VKGAVKPLPQSVTIEVIEGKSPPTTTITMAIDLNVEEQLVKQT 458
                     ::.:.|..|:||..:.|...:|         |..::..|.|:|
  Fly   425 FPDDFELPVIETSPKKKPKSVKSKTIRNVNP---------DKRLKTLLPKET 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/39 (13%)
C2H2 Zn finger 251..271 CDD:275368 5/19 (26%)
COG5048 <256..415 CDD:227381 52/165 (32%)
zf-H2C2_2 263..288 CDD:290200 9/24 (38%)
C2H2 Zn finger 279..327 CDD:275368 14/47 (30%)
zf-H2C2_2 320..342 CDD:290200 10/23 (43%)
C2H2 Zn finger 335..355 CDD:275368 5/21 (24%)
C2H2 Zn finger 363..383 CDD:275368 9/19 (47%)
zf-C2H2 389..411 CDD:278523 7/24 (29%)
C2H2 Zn finger 391..411 CDD:275368 6/22 (27%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 62/210 (30%)
C2H2 Zn finger 214..234 CDD:275368 4/19 (21%)
C2H2 Zn finger 244..264 CDD:275368 5/19 (26%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..349 CDD:275368 3/18 (17%)
C2H2 Zn finger 357..377 CDD:275368 9/19 (47%)
C2H2 Zn finger 387..408 CDD:275368 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446622
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.