DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and Kr-h1

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_477466.1 Gene:Kr-h1 / 33861 FlyBaseID:FBgn0266450 Length:845 Species:Drosophila melanogaster


Alignment Length:462 Identity:119/462 - (25%)
Similarity:179/462 - (38%) Gaps:81/462 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PLDGYPEHFRLKHFTNSSSSLCSNELESDPIAQDVVEVQGNEELHEELAKEASPDLEEEEEEKEE 106
            |..|..|||               ||...| .|..:::|..::..:|..:..|..|..::.:|: 
  Fly    96 PSGGQQEHF---------------ELLQTP-QQRQMQLQLQDQHQQEQQQFVSYQLAIQQHQKQ- 143

  Fly   107 GSKRQHYQRAAAMKNTLVETREDLLDIELDWTGGEQSEHNETHEEEEGESDDDDTKDSNDTKDML 171
                |..|:..::.|...........|:.:..||..:......:..:..:....           
  Fly   144 ----QQQQQHESITNAAPTAAPSAQRIKTEPVGGFPASAAVVSQVRKPSASKPQ----------- 193

  Fly   172 FQCDQCDRAYNTKRSLQSHRRLKHSE-----ANGGS-------LDKSASERNSKKRK-GPPK--- 220
            |:||||...:.:|.:..||.: .||:     .||.|       :..:|.|.|..... |.||   
  Fly   194 FKCDQCGMTFGSKSAHTSHTK-SHSKNQDLSLNGASGAGVAAPVSTAAIELNDAGLPVGIPKSPT 257

  Fly   221 ------------VYKCNEEACNQTFRTERDLRGHRWKHTG---IFCDICGKPFTQSGNMMRHRQR 270
                        .|:||  .|.:||.....|..|...|||   ..|:.|.|.|:...|:..||:.
  Fly   258 IKPLANVAAGADPYQCN--VCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRI 320

  Fly   271 HSGIKPHKCPECDATFYTQKELSSHSICHTGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKC 335
            |:..:|:||..|...|....:|..|...|||..|..|.||.:.....|.|..|||.||||:|.||
  Fly   321 HTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKC 385

  Fly   336 EV--CGKAFYSFHDLNVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTF 398
            ..  |||.|.....|.||:.:||..:|:.||:|...|.....|::|::.|...:.|.|.:|.:||
  Fly   386 PEPGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETF 450

  Fly   399 AQSGGLNAHMRSH------DPARVKGAVKPLPQSVTIEVIEGKSPPTTTITMAIDLNVEEQLVKQ 457
            .....:.||::.|      |.|....|      |.......|.|..:.:: ..:..|.|......
  Fly   451 KNKKEMEAHIKGHANEVPDDEAEAAAA------SAAASTSAGSSAGSPSL-QGVSSNSESSNHSP 508

  Fly   458 TETAPTT 464
            ..:.|.|
  Fly   509 PSSPPAT 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 7/21 (33%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 58/166 (35%)
zf-H2C2_2 263..288 CDD:290200 9/24 (38%)
C2H2 Zn finger 279..327 CDD:275368 17/47 (36%)
zf-H2C2_2 320..342 CDD:290200 14/23 (61%)
C2H2 Zn finger 335..355 CDD:275368 8/21 (38%)
C2H2 Zn finger 363..383 CDD:275368 6/19 (32%)
zf-C2H2 389..411 CDD:278523 7/21 (33%)
C2H2 Zn finger 391..411 CDD:275368 6/19 (32%)
Kr-h1NP_477466.1 C2H2 Zn finger 196..216 CDD:275368 7/20 (35%)
COG5048 <270..420 CDD:227381 58/151 (38%)
zf-C2H2 271..293 CDD:278523 8/23 (35%)
C2H2 Zn finger 273..293 CDD:275368 7/21 (33%)
zf-H2C2_2 286..309 CDD:290200 8/22 (36%)
C2H2 Zn finger 301..321 CDD:275368 7/19 (37%)
zf-H2C2_2 313..338 CDD:290200 9/24 (38%)
C2H2 Zn finger 329..349 CDD:275368 5/19 (26%)
zf-H2C2_2 344..366 CDD:290200 8/21 (38%)
C2H2 Zn finger 357..377 CDD:275368 8/19 (42%)
zf-H2C2_2 370..396 CDD:290200 15/25 (60%)
C2H2 Zn finger 385..407 CDD:275368 8/21 (38%)
zf-H2C2_2 400..424 CDD:290200 10/23 (43%)
C2H2 Zn finger 415..435 CDD:275368 6/19 (32%)
zf-C2H2 441..463 CDD:278523 7/21 (33%)
C2H2 Zn finger 443..463 CDD:275368 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.