DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG17612

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_608824.1 Gene:CG17612 / 33639 FlyBaseID:FBgn0031597 Length:618 Species:Drosophila melanogaster


Alignment Length:447 Identity:98/447 - (21%)
Similarity:146/447 - (32%) Gaps:131/447 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 LESDPIAQDVVEVQGNEELHEELAKEASPDLEEEEEEKEE-----------------GSKRQHYQ 114
            ||..|...||:.:|      :.:|:|..|.::||..|.|:                 ||.|...:
  Fly   134 LEDHPANNDVIIIQ------DSVAEEELPVIKEEAIEGEDLQGEYFIITECLEEPAIGSCRVCLE 192

  Fly   115 RAAAMKNTLVETRE---DLLDIELDWTGGEQSEHNETHEEEEGESDD---------------DDT 161
            ::..:.|...:..:   .:..|...:||         ...|:|:|..               ||.
  Fly   193 QSDNLTNIFDDAHQYGIPIATILSQYTG---------MPVEKGDSFSEYICVTCLDVVKNAFDDL 248

  Fly   162 KDSNDTKDMLFQ-----------------------------CDQCDRAYNTKRSLQSHRRLKHSE 197
            :...:|..|..|                             |.||.:.:.....||:|.|     
  Fly   249 ESKENTIQMYRQPKEEIIDIDSIPVKNKPVDYEVTGKPPHRCPQCPKIFLLAAKLQAHIR----- 308

  Fly   198 ANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQTFRTERDLRGHRWKHTG-----------IFC 251
                       ..|..:...||:: ||  ..|...:.....|..|.|.|..           ..|
  Fly   309 -----------THNETRTTEPPRL-KC--PMCPSIYMKRGCLEAHMWIHRASDERESELEPPYRC 359

  Fly   252 DICGKPFTQSGNMMRHRQRHSGI-------KPHKCPECDATFYTQKELSSHSICHTGRMPCICEV 309
            ..|.|.|..|..:..|.|.|..:       ..|||.:|...|.....|..|...|.|.....|.:
  Fly   360 PHCPKLFLYSSFLEIHIQTHEDVSQRLSRKSSHKCAQCADVFSDVSSLKDHVKIHAGERTFKCPL 424

  Fly   310 CGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLNVH-AVSHTNLRPFVCDVCGSTFQRK 373
            |....::...|.:|...||   ..||..|.|.|.|.:.|:.| ..|||...||.|..|..|||::
  Fly   425 CLMSFQEESNLKSHDCAHT---RFKCHKCSKFFESQNYLDFHFKKSHTTKGPFKCIKCQQTFQKR 486

  Fly   374 KALRVH-------KLLHSEQ--RKYACKLCGKTFAQSGGLNAHMRSHDPARVKGAVK 421
            ..|:.|       :.|.|:.  :.:.|..|.|.|:.......|..:|  .:||..::
  Fly   487 NGLKEHISSQVCVQFLRSKSPGQIFPCPKCPKKFSIEDNYQMHHATH--KKVKTVIE 541

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 7/19 (37%)
COG5048 <256..415 CDD:227381 49/175 (28%)
zf-H2C2_2 263..288 CDD:290200 8/31 (26%)
C2H2 Zn finger 279..327 CDD:275368 11/47 (23%)
zf-H2C2_2 320..342 CDD:290200 8/21 (38%)
C2H2 Zn finger 335..355 CDD:275368 7/20 (35%)
C2H2 Zn finger 363..383 CDD:275368 7/26 (27%)
zf-C2H2 389..411 CDD:278523 5/21 (24%)
C2H2 Zn finger 391..411 CDD:275368 5/19 (26%)
CG17612NP_608824.1 zf-AD 187..>246 CDD:285071 8/67 (12%)
C2H2 Zn finger 290..310 CDD:275368 7/35 (20%)
C2H2 Zn finger 323..343 CDD:275370 5/21 (24%)
zf-C2H2_8 356..438 CDD:292531 20/81 (25%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
C2H2 Zn finger 394..414 CDD:275368 5/19 (26%)
C2H2 Zn finger 422..438 CDD:275368 3/15 (20%)
C2H2 Zn finger 447..463 CDD:275368 6/15 (40%)
C2H2 Zn finger 476..505 CDD:275368 8/28 (29%)
C2H2 Zn finger 513..533 CDD:275368 5/19 (26%)
C2H2 Zn finger 545..565 CDD:275368
C2H2 Zn finger 568..584 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449784
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.