DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG8944

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_573065.1 Gene:CG8944 / 32517 FlyBaseID:FBgn0030680 Length:762 Species:Drosophila melanogaster


Alignment Length:468 Identity:101/468 - (21%)
Similarity:161/468 - (34%) Gaps:137/468 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 HFRLKHFTNSSSSLCSNELESDPIAQD---------------VVEVQGNEELHEELAKEASPDLE 98
            :|:..||.|...|.  |:..||.:.::               ..::....:.::.......||. 
  Fly   337 YFKELHFLNEVYSY--NDKMSDAVVKETSYRRRFSAIWNDTSTAKLLSMVKRYQCFYNRFDPDY- 398

  Fly    99 EEEEEKEEGSKRQHYQRAAAMKNTLVETREDLLDIELDWTG-----------GEQSEHNETHEEE 152
            ..:|.:.||..:...:....:..|.::..:.:..:..|::.           |::...|..:.::
  Fly   399 RSKERRGEGLHQMAIELQQLIDVTTIQISKRISQLRFDYSKQKMERLNSERLGKKFIANYLYYDQ 463

  Fly   153 EGESDDDDTKDSNDTKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKG 217
            ....|||...         |:|..|.....|.|.|..| .|.|..:.||.               
  Fly   464 MHFMDDDIPP---------FKCAHCPEIVQTLRELDLH-MLTHQPSLGGG--------------- 503

  Fly   218 PPKVYKCNEEACNQTFRTERDLRGHRWKHTG------IFCDICGKPFTQSGNMMRHRQRHSGIKP 276
                |.||  .|:..|...::...|:..|.|      ..|::|...|.:..|...|.:||:    
  Fly   504 ----YYCN--ICSIQFHNAQEFDNHKQLHLGGVTEIKFNCELCTASFREKANYDEHLRRHN---- 558

  Fly   277 HKCPECDATFYTQKELSSHSICHTG---------------------------------------- 301
                  :..|.....| :|||...|                                        
  Fly   559 ------EELFLPSLAL-NHSIMEGGLGDDEIGVEGEESRGSGSRRKRRHAAKATDDMVDDDDRIG 616

  Fly   302 --------------RMPCICEVCGRPCRDRGVLTAHMRRHTGERPA--KCEV--CGKAFYSFHDL 348
                          ..|..|:||.|.....|.|.||...|..||..  ||:.  |.|:|.:.:.|
  Fly   617 GGGGGGSGGGGTDIAKPYGCDVCRRSFATPGHLNAHRIVHQDERERCYKCDYPQCNKSFVARNSL 681

  Fly   349 NVHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHMRSHDP 413
            ..|...|.:...|.||:||.||:..|.|:.||.:|.:.::|.|::||..|||:.||..|.|.|: 
  Fly   682 FEHLKQHYSNEEFKCDICGKTFKSTKNLQNHKQIHDKIKRYVCQICGSAFAQAAGLYLHKRRHN- 745

  Fly   414 ARVKGAVKPLPQS 426
             |..|||..:.:|
  Fly   746 -RPNGAVGAVGRS 757

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 5/21 (24%)
C2H2 Zn finger 251..271 CDD:275368 5/19 (26%)
COG5048 <256..415 CDD:227381 55/216 (25%)
zf-H2C2_2 263..288 CDD:290200 5/24 (21%)
C2H2 Zn finger 279..327 CDD:275368 15/101 (15%)
zf-H2C2_2 320..342 CDD:290200 10/25 (40%)
C2H2 Zn finger 335..355 CDD:275368 6/21 (29%)
C2H2 Zn finger 363..383 CDD:275368 10/19 (53%)
zf-C2H2 389..411 CDD:278523 11/21 (52%)
C2H2 Zn finger 391..411 CDD:275368 10/19 (53%)
CG8944NP_573065.1 MADF_DNA_bdg 259..344 CDD:287510 2/6 (33%)
MADF 379..472 CDD:214738 12/93 (13%)
C2H2 Zn finger 476..496 CDD:275368 7/20 (35%)
C2H2 Zn finger 506..526 CDD:275368 5/21 (24%)
C2H2 Zn finger 537..557 CDD:275368 5/19 (26%)
C2H2 Zn finger 636..656 CDD:275368 8/19 (42%)
zf-C2H2_8 639..712 CDD:292531 26/72 (36%)
C2H2 Zn finger 666..688 CDD:275368 6/21 (29%)
zf-C2H2 694..716 CDD:278523 11/21 (52%)
C2H2 Zn finger 696..716 CDD:275368 10/19 (53%)
zf-H2C2_2 708..733 CDD:290200 9/24 (38%)
C2H2 Zn finger 724..744 CDD:275368 10/19 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.