DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18262 and CG11695

DIOPT Version :9

Sequence 1:NP_572453.1 Gene:CG18262 / 31745 FlyBaseID:FBgn0030012 Length:469 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:564 Identity:113/564 - (20%)
Similarity:174/564 - (30%) Gaps:208/564 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RCGEVLFSAPASYEVSC-LLCDQRLPLDGYPEHFRLKHFTNSSSS------LCSNELESDPIAQD 75
            :|.:.|    |.:|..| ::..::|.|    :..:::.|:....:      ||..|::..|.|.|
  Fly    56 QCWQQL----ADFEQFCAMVMKKQLGL----QQLKMEPFSEDEDADTKAQILCEPEIDVSPAAAD 112

  Fly    76 VVEVQGNEELHE--------------------EL-----------------------------AK 91
                  |||.:|                    |:                             .|
  Fly   113 ------NEECNEIDGDASSNSRSSSIRTTSLREMRLPSPIRRRMRLPRAVTAPKTQAVKAKARTK 171

  Fly    92 EASPDLEEEEEEKEEGSKRQHYQRAAAMKNTL-VETREDLLDIELDWTGG--------EQSEHNE 147
            ....:.:|:|:.:.||........:..|.:.: :..|     :|....||        |...|..
  Fly   172 THKAEADEDEDAEGEGDPESRSSNSREMDSYIALHGR-----LECCICGGDEQFPNFAEMKRHFR 231

  Fly   148 THEEEEG---------------------ESDDD-------------------------DTKDSND 166
            .|.:..|                     .:|.:                         ..||   
  Fly   232 NHHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNYFRCKICSKQLVSRISYDVHMLRFHPNKD--- 293

  Fly   167 TKDMLFQCDQCDRAYNTKRSLQSHRRLKHSEANGGSLDKSASERNSKKRKGPPKVYKCNEEACNQ 231
              |:.|.||||.:.::.:..|..|.|:...|.|                      .:|..  |::
  Fly   294 --DLSFACDQCSKRFSKQFLLTIHSRVHQQERN----------------------EQCKH--CDR 332

  Fly   232 TFRTERDLRGH-RWKHTGIF----CDICGKPFTQSGNMMRHRQ---RHSGIKPH-KCPECDATFY 287
            :|||..|||.| |..|...|    ||.||..|....|::.|::   |.....|. :|.||.....
  Fly   333 SFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFKTKQNLLVHKRTVHREGSQLPEVQCQECQVWLS 397

  Fly   288 TQKELSSHSICH---TGRMPCICEVCGRPCRDRGVLTAHMRRHTGERPAKCEVCGKAFYSFHDLN 349
            .:..|..|...|   .......||.||.....|..|.||:|.|..:...||..|.|.|.|...|.
  Fly   398 DENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIRYHHPKEYHKCTHCAKEFKSSRSLE 462

  Fly   350 VHAVSHTNLRPFVCDVCGSTFQRKKALRVHKLLHSEQRKYACKLCGKTFAQSGGLNAHMRSHDPA 414
            .|..:||.                            |..|.|..|.:||..||.::.|.|....|
  Fly   463 EHTATHTG----------------------------QDLYECAFCERTFKNSGNMHKHRRQMHAA 499

  Fly   415 RVKG--AVKPLPQS-------VTIEVIEGKSPPTTTITMAIDLN 449
            :|..  ..|.:|.|       :.::|:.......:.:..|.|:|
  Fly   500 QVAALQQQKKVPPSKRKDKGDLLLDVLAAGGKDMSHVMGAGDMN 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18262NP_572453.1 C2H2 Zn finger 224..246 CDD:275368 10/22 (45%)
C2H2 Zn finger 251..271 CDD:275368 7/22 (32%)
COG5048 <256..415 CDD:227381 41/165 (25%)
zf-H2C2_2 263..288 CDD:290200 7/28 (25%)
C2H2 Zn finger 279..327 CDD:275368 15/50 (30%)
zf-H2C2_2 320..342 CDD:290200 9/21 (43%)
C2H2 Zn finger 335..355 CDD:275368 7/19 (37%)
C2H2 Zn finger 363..383 CDD:275368 0/19 (0%)
zf-C2H2 389..411 CDD:278523 9/21 (43%)
C2H2 Zn finger 391..411 CDD:275368 8/19 (42%)
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 7/32 (22%)
C2H2 Zn finger 268..289 CDD:275368 0/20 (0%)
C2H2 Zn finger 299..319 CDD:275368 7/19 (37%)
C2H2 Zn finger 327..348 CDD:275368 10/22 (45%)
C2H2 Zn finger 357..376 CDD:275368 7/18 (39%)
C2H2 Zn finger 389..409 CDD:275368 5/19 (26%)
C2H2 Zn finger 420..440 CDD:275368 9/19 (47%)
C2H2 Zn finger 448..468 CDD:275368 7/19 (37%)
C2H2 Zn finger 476..494 CDD:275368 7/17 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24390
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.